SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010637 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010637
Domain Number 1 Region: 148-219,266-532
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.75e-93
Family NadC C-terminal domain-like 0.0000238
Further Details:      
 
Domain Number 2 Region: 11-153
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.88e-36
Family NadC N-terminal domain-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010637   Gene: ENSRNOG00000007939   Transcript: ENSRNOT00000010637
Sequence length 538
Comment pep:known chromosome:Rnor_5.0:7:116814964:116818403:-1 gene:ENSRNOG00000007939 transcript:ENSRNOT00000010637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMELDDQGHMVVRPLLTDLYQATMGLGYWRAGRACEEAEFELFFRHCPFGGSFALTAGL
QDCIRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSRVSVRALPEGSLAFPGVP
LLQVSGPLLLVQLLETPLLCLVSYASLVATNAARLRLIAGPDKRLLEMGLRRAQGPDGGF
TASIYSYLGGFDSSSNTLAGQLRGVPVAGTLAHSFITSFLGSEVPPDPMLAPASSEGPAV
DLPASVNLWLKRVCIYLGLEEREPHPGERAAFVAYALAFPRAFQGLLDSYSVRRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAKEIRGIFRTVGAEFQMPWLEFVPIAVSNNIDE
KELARLAQKGSEVNVIGIGTNVVTCPKQPSMGCVYKLVSVGGQPRIKLTEESQKRILPGS
KAAFRFLDSEGSLLLDLLQLAEEPPPKAGQELRVWLQGAQEPCTVKPAQVEPLLRLYLQQ
GQPYEPLPSLEESRAFAQQSLSRLRPAHKQLQNPAVYQVALSEKLRALVDSLSARGAL
Download sequence
Identical sequences G3V709
ENSRNOP00000010637 10116.ENSRNOP00000010637 ENSRNOP00000010637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]