SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011003 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011003
Domain Number 1 Region: 373-504
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-32
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 2 Region: 949-1097
Classification Level Classification E-value
Superfamily C-type lectin-like 4.24e-31
Family C-type lectin domain 0.00079
Further Details:      
 
Domain Number 3 Region: 226-360
Classification Level Classification E-value
Superfamily C-type lectin-like 5.5e-31
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 4 Region: 1234-1379
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-30
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 806-937
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-28
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1115-1230
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-26
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 7 Region: 654-798
Classification Level Classification E-value
Superfamily C-type lectin-like 9.11e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 8 Region: 511-644
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-23
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 9 Region: 165-222
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-21
Family Fibronectin type II module 0.00091
Further Details:      
 
Domain Number 10 Region: 40-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.31e-20
Family Cysteine rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011003   Gene: ENSRNOG00000008129   Transcript: ENSRNOT00000011003
Sequence length 1461
Comment pep:known chromosome:Rnor_5.0:3:51596536:51728234:-1 gene:ENSRNOG00000008129 transcript:ENSRNOT00000011003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWLAMLQLLWLQQLLLGVHQGSAQDLTHTQELALEWRDKGIFIIQSESLKTCIQAGKS
VLTLENCTQPNEYMLWKWVSDNHLFNVGASGCLGLNISDLKRPLSLYECDSTLISLRWLC
DRKTIVGPLQYKVQVNHSTVVAKKTPHKWSAYMPGGGDICEHLHRDIYTLKGNAHGMPCV
FPFQFKGQWHHECIREGHKEHLLWCATTSRYEEDEKWGFCPDPTSTEIFCDAMWQRNDNS
HICYQFNLLSSLSWNEAHSSCQMQGGALLSITDENEEAFIRKELSRVAKEVWTGLNQLDE
MAGWQWSDGTPLSYLNWSQEVTAGPFVEYHCGTLKVASATWRSMDCESTLPYICKRHLNH
TAEDILQKDSWKYHTTHCDPGWTPFNRKCYKLKKEKRTWQEALHSCQSDDSMLMDVTSLA
EVELLVNLLGDENASETWIGLSSNKIPVSFAWSSGSSVIFTNWYLLEPRILPNRRQLCVS
ADQSDGRWKVKGCKETLPYICKKAGQVLEDEDSGCQAGWERHGKYCYKIDTVLRSFEQAS
GGYYCPPALLTITSRFEQAFITSLISSVARKDSYFWIALQDQNNTGEYTWKTMGQREPVQ
YTHWNAHQPSYHGGCVVLRGGSSFGRWEVKNCSDFKAMSLCKTPIKVWEKTEFEGRWPFH
PCYMDWESETGLASCFKVFHSEKVLMKRSWREAEAFCEEFGAHLASFAHIEEENFVNKLL
HSKFNWTQERQFWIGFNKRNPLNAGSWEWSDGSPVVSSFLDNAYFEEDAKNCAVYKANNT
LLPSNCASKHEWICKIPRDVKPNFPVWYQYDAPWLFYQNAEYLFHTHPAEWATFEFVCGW
LRSDFLTIYSAQEQEFIHSKIRALSKYGANWWIGLEDRRAGDQIHWSNGSPVIFQNWDKG
RKGRMDSQRKRCVFMSAITGLWGTENCSVPMPSICKRVKIWVIEKEKPPTQHGTCPKGWL
YFNYKCFLVTIPKDPRELKTWTGAQEFCAAKGGTLVSIESELEQAFITVNLFGQTTNVWI
GLQSDNHENWVNGKPVVYSNWSPSDVINIPNYNTTEVQKRAPLCALMSSNPNFHFTGKWY
FDDCGKKGYGFVCEKMQDTLENHVNVSDTYAVPSTLEYGNRTYKIIRANMTWYAAGKSCR
MQGAELVSIPDVFHQSFLTVLLSRLGHAHWIGLSTPDNGLNFDWSDGTKSPFTYWKDEES
ASLGDCVFADTDGHWHGTACESHLQGAVCRVLTETKSFEHPVLCSETSVPWIRFKGHCYS
FSTVLDSRSFEDAREFCKREGSNLLAIKDEAENLFLLEELLALGSSVQMVWLNAQLDNDN
KTLRWFDGAATEQSNWGVRKPDMDHLKPHPCVVLRIPEGVWQSTPCEDKTGFICKVEAGI
PAVTAHPEKGLSHSIMPVAAALALTIVLGILVLCLWIYKQNGGAILPRLTGSRGPYYPMS
SFSMAHLEENILISDLEKNNQ
Download sequence
Identical sequences F1M495
ENSRNOP00000011003 NP_001094307.1.100692 NP_001094307.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]