SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011026 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011026
Domain Number 1 Region: 1069-1114
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000353
Family Nuclear receptor coactivator interlocking domain 0.00052
Further Details:      
 
Domain Number 2 Region: 123-190
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000012
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000046
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00054
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000445
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011026   Gene: ENSRNOG00000007975   Transcript: ENSRNOT00000011026
Sequence length 1465
Comment pep:known chromosome:Rnor_5.0:5:10456313:10547228:1 gene:ENSRNOG00000007975 transcript:ENSRNOT00000011026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSM
VNGGSWTGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPALPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHTQHEGESLSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQAMGKPLSPMSSSSPARQAMCSGNPGQDVALG
SNMNFPMNGPREQMSMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGLNPG
QPSSVLSPRHRMSPGVAGSPRVPPSQFSPAGSLHSPAGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGPSLASPDLKMGNSQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
EASCHPEEQKRPNDSSMPQAASGDRAEGHSRLHESKGQTKLLQLLTTKSDQMEPSPLPSS
LSDTNKDSTGSLPGPGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELNQESS
GTAPGSEVTVKQEPASPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIAMKTVKEEVSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPTGSVDKQAII
NDLMQLTADSSPVTPVGAQKAALRMSQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG
PFPPIRNSSPYSVIPQPGMMGNQGMLGSQGNLGNNSTGMIGSSTSRSSMPSGEWAPQSPA
VRVTCAATTGAMNRPIQGGMIRNPTASIPMRANSQPGQRQMLQPQVMNIGPSELEMNMGG
PQYNQQQAPPNQTAPWPESILPIDQASFGSQNRHPFGSSPDDLLCPHPAAESPSDEGALL
DQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQESSMMLEQKPPVFPQQYASQ
TQMAQGSYNPMQDPNFHTMGQRPNYTTLRMQPRPGLRPTGIVQNQPNQLRLQLQHRLQAQ
QNRQPLMNQISGVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQ
RTLMMRGQGLNMTPSMVAPTGLPAAMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATT
PQSPLMSPRMAHTQSPMMQQSQANPAYQPASDMNGWAQGSMGGNSMFSQQSPPHFGQQAN
TSMYNNNMNINVSMATNTAGLSNMNQMTGQMSMTSVTSVPTSGLSSMGPEQVNDPALRGS
SLFTTNQLPGMDMIKQEGDGSRKFC
Download sequence
Identical sequences ENSRNOP00000011026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]