SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011178 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011178
Domain Number 1 Region: 38-452
Classification Level Classification E-value
Superfamily Sema domain 2.22e-50
Family Sema domain 0.012
Further Details:      
 
Domain Number 2 Region: 1055-1184,1358-1507
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-28
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 454-506
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000131
Family Plexin repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000011178
Domain Number - Region: 666-752
Classification Level Classification E-value
Superfamily E set domains 0.00255
Family E-set domains of sugar-utilizing enzymes 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011178   Gene: ENSRNOG00000007970   Transcript: ENSRNOT00000011178
Sequence length 1574
Comment pep:known_by_projection chromosome:Rnor_5.0:7:35914416:36063727:-1 gene:ENSRNOG00000007970 transcript:ENSRNOT00000011178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSRRKAPPRPPYPAAPLPLIAYLLALAVPARGADEPVWRSEQAIGAIAASRADGVFVA
SGSCLDQLDYSLKNRLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGATGLE
GLLLTGWTFDRGACEVRPLGNLNRSSLRNGTEVVSCHPQGSTAGVVYRASGTDLWYLAVA
ATYVLPEPETANRCNPAASDRDTAIALKNTEGRSLATQELGRLKLRGSAGSLHFVDAFLW
NGSVYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQAALDCGHGHPEGRRLLLSSSLV
EAVDIWAGVFSAATGEGQEKRSPATTALCLFRMSEIQARARSCSWDFQATEHNCKEGDQP
EQVQPIASSTLIHSDLTSVYGTVVMNRIVLFLGTGDGQLLKVVLGENLTSNCPEVIYEIK
EETPVFYKLVPHPVKDTYIYLTAGKEVRRIQVANCSKRKSCFQCLAAADPHCGWCLPLQR
YFLNGSCHHGRHFLNWRSMAEGPHHCPGCQSLWSQRDRTTVTIVGSVSARHSECVVKNAD
TGKLLCQGRSQMNRTCACNIPSRPSNNVFVVNATFTFPSWSVSERFNFTNCASVRECPAC
IETGCAWCKRDKRCIHPFTPCEPSDYERNQELCHVAVEKPPKDSGGGRVKESKRNRTDPA
LQVFYIKAIEPQKISTLGKSNVIVTGANFTQASNITMILRGTSTCEKDVIRVSHVLNDTH
MKFSLPSSRKEMKDVCIQFDGGNCSSAGALSYIALPHCSLIVPATTWISGGQNITIMGRN
FDVIDNLIISHELKGNINVSINVSEYCMATSCRFLAPNLKSSKGRTNVVVKLRVQDTYLD
CGTLQYLEDPRFTGYRVESEIDTELEVKIQKENDNFNISRDDIDITLFHGENKQFNCSFE
NITRNQDLTTILCKIKSIKNANTIATSSKKVRVKLGNLELYVEQESVPSTWYFLIALPIL
LAIVIVVAVVVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVP
FLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLE
KQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVE
KLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVP
EFNTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLN
EIGLELQVGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVE
YSDDHCHLILPDSEAFQVVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWS
LPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKK
TPHIDSCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPP
LSSLEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQLLH
VKVLFDEKKKCKWM
Download sequence
Identical sequences ENSRNOP00000011178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]