SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011352 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011352
Domain Number 1 Region: 136-322
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.55e-50
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000462
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 8.79e-39
Family DNA repair glycosylase, N-terminal domain 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011352   Gene: ENSRNOG00000008522   Transcript: ENSRNOT00000011352
Sequence length 344
Comment pep:known chromosome:Rnor_5.0:4:208580193:208586457:1 gene:ENSRNOG00000008522 transcript:ENSRNOT00000011352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSSSLSSSMRHRTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGVLA
DQVWTLTQTEDQLYCTVYRGDKGQVGRPTLEELETLHKYFQLDVSLTQLYSHWASVDSHF
QSVAQKFQGVRLLRQDPTECLFSFICSSNNNIARITGMVERLCQAFGPRLVQLDDVTYHG
FPNLHALAGPEVETHLRKLGLGYRARYVCASAKAILEEQGGPAWLQQLRVASYEEAHKAL
CTLPGVGTKVADCICLMALDKPQAVPVDIHVWQIAHRDYGWQPKTSQTKGPSPLANKELG
NFFRNLWGPYAGWAQAVLFSADLRQQNLSREPPAKRKGSKKTEG
Download sequence
Identical sequences ENSRNOP00000011352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]