SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011851 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011851
Domain Number 1 Region: 450-524
Classification Level Classification E-value
Superfamily TGS-like 1.42e-25
Family G domain-linked domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000011851
Domain Number - Region: 247-341
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00279
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011851   Gene: ENSRNOG00000008752   Transcript: ENSRNOT00000011851
Sequence length 534
Comment pep:known chromosome:Rnor_5.0:4:57139899:57198685:1 gene:ENSRNOG00000008752 transcript:ENSRNOT00000011851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATTTHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGPDGVHAWTISKAVTAPQAAGKIHTDFGKGF
IMAEVMKDEDLKEESSENAAKAAGKYKQPGRAYVVEDGDIIFFKFNSPQQLKRK
Download sequence
Identical sequences B1WC04
ENSRNOP00000011851 NP_001094178.1.100692 NP_001094178.1.4139 ENSRNOP00000044018 10116.ENSRNOP00000011851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]