SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011971 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011971
Domain Number 1 Region: 89-191
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.52e-29
Family Iojap/YbeB-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011971   Gene: ENSRNOG00000009035   Transcript: ENSRNOT00000011970
Sequence length 229
Comment pep:known chromosome:Rnor_5.0:4:143423969:143432792:1 gene:ENSRNOG00000009035 transcript:ENSRNOT00000011970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGWSPARRVWPLLWRRVFSQRASPKVSSVPWLPRLAERWLLAGPATCLTPTPSPRGLH
HGPQPEERTEGDARLQPGAADHIGAKFDIDMLVSLLKQENARDICVIKVPPEMRYTDYFV
IGSGTSTRHLHAMVHYIVKTYKHLKCRSDPYVKIEGKDTDDWLCVDFGSMVIHLMLPETR
ETYELEKLWTLRSFDDQLAQIAAETLPEDFILGLEDDTSSLTPMEFKCK
Download sequence
Identical sequences D3ZZ37
ENSRNOP00000011971 10116.ENSRNOP00000011971 NP_001100063.1.100692 NP_001100063.1.4139 ENSRNOP00000011971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]