SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012235 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012235
Domain Number 1 Region: 241-389,441-592
Classification Level Classification E-value
Superfamily TROVE domain-like 1.14e-67
Family TROVE domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 1814-1984,2059-2191
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.27e-56
Family WD40-repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 1677-1885
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.51e-38
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 4 Region: 2115-2321,2568-2599
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-30
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 5 Region: 2291-2357,2453-2510,2555-2628
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000641
Family WD40-repeat 0.016
Further Details:      
 
Domain Number 6 Region: 1160-1405
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000232
Family Nitrogenase iron protein-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012235   Gene: ENSRNOG00000008964   Transcript: ENSRNOT00000012235
Sequence length 2629
Comment pep:known chromosome:Rnor_5.0:15:31583613:31631251:-1 gene:ENSRNOG00000008964 transcript:ENSRNOT00000012235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLCGYVPVHPDILSLKNRCLTMLSDIQPLEKIHGQRSVNPDILSLENRCLTLLPDLQP
MEKIHGQRSVHPDILSSENRCLTLLPDLQSLEKLCGHMSSHPDVLSLENRCLATLPTVKR
TVSSGPLLQCLHRSHTAQADLRDPNFRNCLFPEPPTIEAPCFLKELDLPTGPRALKSMSA
TARVQEVALGQRCVSEGKELQEEKESAEVPMPLYSLSLGGEEEEVVGAPVLKLTSGDSDS
HPETTDQILQEKKMALLTLLCSAMASSVNVKDASDPTRASIHEVCSALAPLEPEFILKAS
LYARQQLNLRDIANIVLAVAALLPACRPHVRRYYSAIVHLPSDWIQVAEFYQSLAEGDEK
KLVPLPACLRAAMTDKFAQFDEYQLAKYNPRKHRSKTRSRQPPRPQRTKPPFSESGKCFP
KSVWPLKNEQISFEAAYNAVSEKKRLPRFTLKKLVEQLHIHEPAQHVQALLGYRYPSTLE
LFSRSHLPGPWDSSRAGQRMKLQRPETWERELSLRGNRASVWEELIDNGKLPFMAMLRNL
CNLLRTGISAHHHELVLQRLQHEKSVIHSRQFPFRFLNAHDSLDRLEAQLRSKASPFPSN
TTLMKRIMIRNSKKIKRPANPRYLCTLTQRQLRAAMAIPVMYEHLKREKLRLHKARQWTC
DLELLERYRQALETAVNISVKHNLPPLPGRTLLVYLTDANANRLCPKSHLQGPPLNYVLL
LIGMMMARAEQTTVWLCGTGTVKTPVLTADEGILKTAIKLQAQVQELEENDEWPLETFEK
YLLSLAVRRTPIDRVILFGQRMDTELLNVAKQIIWQHVNSKCLFVSVLLRKMQYMSPNLN
PNDVTLSGCTDGILKFIAEHGASRLLEHVGQLDKIFKIPPPPGKTKVSPLRPLEENNPGP
FVPISQHGWRNIRLFISSTFRDMHGERDLLMRSVLPALQARAFPHRISLHAIDLRWGITE
EETRRNRQLEVCLGEVENSQLFVGILGSRYGYTPPSYDLPDHPHFHWTQRYPSGRSVTEM
EVMQFLNRGQRSEPSDQALIYFRDPGFLSSVPDVWKPDFISESEEAAHRVSELKRFLQEQ
KEVTCRRYSCEWGGVAAGRPYTGGLEEFGQLVLQDVWSVIQKRYLQPGAQLEQPGSISEE
DLIQASFQQLKSPPSPARPRLLQDTVQQLMLPHGRLSLVIGQAGQGKTAFLASLVSALKV
PDQPNVAPFVFFHFSAARPDQCLAFNLLRRLCTHLHQKLGEPSALPSTYRGLVWELQQKL
LLKSAQWLQPGQTLVLIIDGADKLVDHNGQLISDWIPKSLPRRVHLVLSVSSDSGLGETL
QQSQSAYVVALGSLVPSSRAQLVREELALYGKRLEESPFNNQMRLLLAKQGSSLPLYLHL
VTDYLRLFTLYEQVSERLRTLPATLPLLLQHILSTLEQEHGHNVLPQALTALEVTHSGLT
VDQLHAVLSTWLTLPKETKSWEEAVAASHSGNLYPLAPFAYLVQSLRSLLGEGPVERPGA
RLCLSDGPLRTAVKRRYGKRLGLEKTAHVLIAAHLWKMCDPDASGTFRSCPPEALKDLPY
HLLQSGNHGLLAKFLTNLHVVAAYLEVGLVPDLLEAYELYASSKPEVNQKLPEADVAVFH
NFLKQQASLLTQYPLLLLQQAASQPEESPVCCQAPLLTQRWHNQCILKWINKPQTLKGQQ
SLSLPISSSPTAVAFSPNGQRAAVGTAGGTIYLLNLRTWQEEKALVSGCDGISSFAFLSD
TALFLTTFDGLLELWDLQHGCWVFQTKAHQYQITGCCLSPDRRLLATVCLGGYVKLWDTV
QGQLAFQYTHPKSLNCITFHPEGQVVATGNWSGIVTFFQADGLKVTKELGGPGPSVRTLA
FSAPGKVVALGRIDGTVELWAWQEGTRLAAFPAQCGGVSTVLFLHAGGRFLTAGEDGKAQ
LWSGFLGRPRGCLGSLYLSPALSVALNPDGDQVAVGYRGDGIKIYRISSGPQEAQCQELN
VAVSALVWLSPSVLVSGAEDGSLHGWMLRRNSLQSLWLSSVCQKPVLGLAASQEFLASAS
EDFTVRLWPRQLLTQPHAVEELPCAAELRGHEGPVCCCSFSPDGRILATAGRDRNLLCWD
VKVAQAPLLIHTFSSCHRDWITGCTWTKDNILISCSSDGSVGLWNPEAGQQLGQFPGHQS
AVSAVVAVEEHIVSVSRDGTLKVWDRQGVELTSIPAHSGPISQCAAALEPRPAGQPGSEL
LVVTVGLDGATKLWHPLLVCQIHTLQGHSGPVTAAAASEASGLLLTSDNSSVRLWQIPKE
ADDTCKPRSSAVITAVAWAPDGSLVVSGNEAGELTLWQKAQAVATARAPGRVSDLIWCSA
NAFFVLSANENVSEWQVELRKGSTCTNFRLYLKRVLQEDLGVLTGMALAPDGQSLILMKE
DVELLQMKPGSTPSSICRRYAVHSSILCTSKDYGLFYLQQGNSGSLSILEQEESGKFEKT
LDFNLNLNNPNGSPVSITQAEPESGSSLLCATSDGMLWNLSECTPEGEWVVDNIWQKKSR
NPKSRTPGTDSSPGLFCMDSWVEPTHLKARQCKKIHLGSVTALHVLPGLLVTASEDRDVK
LWERPSMQLLGLFRCEGPVSCLEPWMEPSSPLQLAVGDAQGNLYFLSWE
Download sequence
Identical sequences F1LPX8
ENSRNOP00000012235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]