SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012725 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012725
Domain Number 1 Region: 342-676
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.71e-131
Family Transferrin 0.000000000567
Further Details:      
 
Domain Number 2 Region: 21-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.76e-110
Family Transferrin 0.000000000841
Further Details:      
 
Domain Number 3 Region: 773-977
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.76e-30
Family G proteins 0.00000000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012725   Gene: ENSRNOG00000030625   Transcript: ENSRNOT00000012725
Sequence length 979
Comment pep:known chromosome:Rnor_5.0:8:111064527:111112746:-1 gene:ENSRNOG00000030625 transcript:ENSRNOT00000012725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFAVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPADGPRLACVK
KTSYQDCIKAISGGEADAITLDGGWVYDAGLTPNNLKPVAAEFYGSLEHPQTHYLAVAVV
KKGTDFQLNQLQGKKSCHTGLGRSAGWIIPIGLLFCNLPEPRKPLEKDPVAFPQLCQLCP
GCGCSPTQPFFGYVGAFKCLRDGGGDVAFVKHTTIFEVLPQKADRDQYELLCLDNTRKPV
DQYEDCYLARIPSHAVVARNGDGKEDLIWEILKVAQEHFGKGKSKDFQLFGSPLGKDLLF
KDSAFGLLRVPPRMDYRLYLGHSYVTAIRNQREGVCPEGSIDSAPVKWCALSHQERAKCD
EWSVSSNGQIECESAESTEDCIDKIVNGEADAMSLDGGHAYIAGQCGLVPVMAENYDISS
CTNPQSDVFPKGYYAVAVVKASDSSINWNNLKGKKSCHTGVDRTAGWNIPMGLLFSRINH
CKFDEFFSQGCAPGYKKNSTLCDLCIGPAKCAPNNREGYNGYTGAFQCLVEKGDVAFVKH
QTVLENTNGKNTAAWAKDLKQEDFQLLCPDGTKKPVTEFATCHLAQAPNHVVVSRKEKAA
RVSTVLTAQKDLFWKGDKDCTGNFCLFRSSTKDLLFRDDTKCLTKLPEGTTYEEYLGAEY
LQAVGNIRKCSTSPVITPKNYNSRDAQRPAAAWSLGPRIFGDPGRPRTSFMASANTRRVG
DGAGGAFQPYLDSLRQELQQRDPTLLSVAVAVLAVLLTLVFWKFIWSRKSSQRAVLFVGL
CDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHESLRLQFLDRF
KSSARAVVFVVDSATFQREVKDVAEFLYQVLIDSMALKNTPAFLVACNKQDIAMAKSAKL
IQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGR
GDAGSADVQDLEKWLAKIA
Download sequence
Identical sequences Q7TMC7
ENSRNOP00000012725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]