SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012946 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012946
Domain Number 1 Region: 154-495
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.86e-135
Family Transferrin 0.000000000334
Further Details:      
 
Domain Number 2 Region: 65-144
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.57e-18
Family Transferrin 0.0000384
Further Details:      
 
Domain Number 3 Region: 20-68
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000217
Family Transferrin 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012946   Gene: ENSRNOG00000030625   Transcript: ENSRNOT00000012946
Sequence length 496
Comment pep:known chromosome:Rnor_5.0:8:111086148:111112746:-1 gene:ENSRNOG00000030625 transcript:ENSRNOT00000012946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFAVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPADGPRLACVK
KTSYSHAVVARNGDGKEDLIWEILKVAQEHFGKGKSKDFQLFGSPLGKDLLFKDSAFGLL
RVPPRMDYRLYLGHSYVTAIRNQREGVCPEGSIDSAPVKWCALSHQERAKCDEWSVSSNG
QIECESAESTEDCIDKIVNGEADAMSLDGGHAYIAGQCGLVPVMAENYDISSCTNPQSDV
FPKGYYAVAVVKASDSSINWNNLKGKKSCHTGVDRTAGWNIPMGLLFSRINHCKFDEFFS
QGCAPGYKKNSTLCDLCIGPAKCAPNNREGYNGYTGAFQCLVEKGDVAFVKHQTVLENTN
GKNTAAWAKDLKQEDFQLLCPDGTKKPVTEFATCHLAQAPNHVVVSRKEKAARVSTVLTA
QKDLFWKGDKDCTGNFCLFRSSTKDLLFRDDTKCLTKLPEGTTYEEYLGAEYLQAVGNIR
KCSTSRLLEACTFHKS
Download sequence
Identical sequences ENSRNOP00000012946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]