SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013043 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013043
Domain Number 1 Region: 188-424
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.22e-58
Family NadC C-terminal domain-like 0.053
Further Details:      
 
Domain Number 2 Region: 247-485
Classification Level Classification E-value
Superfamily PDB 1.02e-56
Family PDB 0.027
Further Details:      
 
Domain Number 3 Region: 10-223
Classification Level Classification E-value
Superfamily PDB 6.45e-52
Family PDB 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013043   Gene: ENSRNOG00000009754   Transcript: ENSRNOT00000013043
Sequence length 491
Comment pep:known chromosome:Rnor_5.0:6:61753125:61787574:1 gene:ENSRNOG00000009754 transcript:ENSRNOT00000013043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFY
GLQYILNKYLKGKVVTKEKIQEAKEVYREHFQDDVFNERGWNYILEKYDGHLPIEVKAVP
EGSVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGY
SVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKVLDILGKKFPVSENSKGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKQKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGVNVFKDPVAD
PNKRSKKGRLSLHRTPAGTFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNA
QLNMEQDVAPH
Download sequence
Identical sequences Q80Z29
NP_808789.1.100692 NP_808789.1.4139 2g95_A 2g95_B 2g96_A 2g96_B 2g97_A 2g97_B 3g8e_A 3g8e_B ENSRNOP00000013043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]