SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013182 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013182
Domain Number 1 Region: 4-453
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 3.4e-115
Family 2-methylcitrate dehydratase PrpD 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013182   Gene: ENSRNOG00000009919   Transcript: ENSRNOT00000013182
Sequence length 488
Comment pep:known chromosome:Rnor_5.0:15:97100761:97109707:1 gene:ENSRNOG00000009919 transcript:ENSRNOT00000013182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLKSVTESFASMIHGLRVGHLTDGVIQRSKRMILDSLGVGFLGTGTEVFHNVTQYSKIY
SSNTSSTVWGRPDFRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALSEALP
QTPKFSGLDLLLAFSVGIEVQGRLLHFSKEAKDIPKRFHPPSVVGTLGSAAATSKFLGLS
LTKCREALAIAVSHAGAPIANAATQTKPLHIGNAAKHGMEATFLAMLGLQGNKQILDLGS
GFGAFYANYSPKDLPSLDSHIWLLDQQDVAFKSFPAHLATHWVADAAAAVRKHLVTSERA
LLPADHIERIVLRIPDVQYVNRPFPDSEHEARHSFQYVACATLLDGSVTVPSFYSQKVNR
PQVKELLKKVELEHPPDNLPSFNTLYCEISITLKDGTTFTERSDTFYGHWRKPLSQEDLH
KKFRANASKILGEDTVESLITVVEKLEDLEDCAMLTRLLKGPSVQEEASKLSSIFSFHHT
SLPKFTNI
Download sequence
Identical sequences D3ZWM1
ENSRNOP00000013182 10116.ENSRNOP00000013182 NP_001100752.1.100692 NP_001100752.1.4139 ENSRNOP00000013182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]