SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013205 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013205
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-34
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 112-206
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000154
Family Calbindin D9K 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013205   Gene: ENSRNOG00000009886   Transcript: ENSRNOT00000013205
Sequence length 211
Comment pep:known chromosome:Rnor_5.0:4:149413605:149428266:-1 gene:ENSRNOG00000009886 transcript:ENSRNOT00000013205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFFLWNANLTLWVTVLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPVWFTLGILEVLKGWDQGLKGMCVGEKRKLTIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKHEVKVYLQNEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYVHDEL
Download sequence
Identical sequences Q5XID8
ENSRNOP00000061712 NP_001013228.1.100692 NP_001013228.1.4139 10116.ENSRNOP00000013205 ENSRNOP00000013205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]