SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013257 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013257
Domain Number 1 Region: 382-644
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.06e-77
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 263-370
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-33
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 98-147
Classification Level Classification E-value
Superfamily Kringle-like 2.1e-16
Family Fibronectin type II module 0.0017
Further Details:      
 
Domain Number 4 Region: 158-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000119
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 5 Region: 196-236
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000907
Family Fibronectin type I module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013257   Gene: ENSRNOG00000009572   Transcript: ENSRNOT00000013257
Sequence length 653
Comment pep:known chromosome:Rnor_5.0:14:81655786:81662339:-1 gene:ENSRNOG00000009572 transcript:ENSRNOT00000013257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQRAWLPSVSSRPCPFLLLLLLLVVPRVAQPQAGRNHTEPPGPNVTATRMTPMIPATSG
NFSTSIGSDPEGEAETEGPQSERYLLSSSSSPLGGQVLTESGQPCRFPFRYGGRMLHSCS
SEGSAYRKWCATTHNYDRDRAWGYCAEATLPVEGPAVLDPCASGPCLNGGTCSSTQDHVS
YHCACPLAFTGKDCGTEKCFDETRYEYFEVGDHWARVSEGHVEQCSCIEGQARCEDTHHT
ACLSSPCLNGGTCHLIVGTGTSICACPLGYAGRFCNIVPTERCFLGNGTEYRGVASTSAS
GLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDKDERPWCYVVKDSALSWEYCR
LAACESLARVHSRIPEVLATLPESTSTARPTCGKRHKKRTFLRPRIIGGSSSLPGSHPWL
AAIYIGNGFCAGSLVHTCWVVSAAHCFSSSPPRDSITVVLGQHFFNRTTDVTQTFAIEKY
VPYTLYSVFNPNDHDLVLIRLKKKGERCAVRSQFVQPICLPEAGSSFPTGHKCQIAGWGH
MDENVSGYSNSLLEALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPL
VCEKNGVAYLYGIISWGDGCGRLNKPGVYTRVSNYVDWINDRIRPPKRPAAAS
Download sequence
Identical sequences Q5EBA7
NP_445772.1.100692 NP_445772.1.4139 ENSRNOP00000013257 ENSRNOP00000013257 10116.ENSRNOP00000013257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]