SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013354 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013354
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.03e-99
Family Carbonic anhydrase 0.000000000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013354   Gene: ENSRNOG00000009629   Transcript: ENSRNOT00000013354
Sequence length 260
Comment pep:known chromosome:Rnor_5.0:2:107871643:107886834:-1 gene:ENSRNOG00000009629 transcript:ENSRNOT00000013354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHWGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVASKSIV
NNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHL
VHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITEALHSIKTKGKRAAFANFDP
CSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELM
VDNWRPAQPLKNRKIKASFK
Download sequence
Identical sequences P27139
ENSRNOP00000013354 ENSRNOP00000013354 NP_062164.1.100692 NP_062164.1.4139 10116.ENSRNOP00000013354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]