SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013979 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013979
Domain Number 1 Region: 46-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.93e-47
Family Glutathione peroxidase-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013979   Gene: ENSRNOG00000010461   Transcript: ENSRNOT00000013979
Sequence length 209
Comment pep:known chromosome:Rnor_5.0:2:63940890:63944583:-1 gene:ENSRNOG00000010461 transcript:ENSRNOT00000013979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLGAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRINSFYSFEVKDAKGRMV
SLEKFKGKASLVVNVASDCRFTDKSYETLRELHKEFGPYHFNVLAFPCNQFGESEPKSSK
EVESFARKNYGVTFPIFHKIKILGPEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPLEAIRPHVSQMIGQIILKKKEDL
Download sequence
Identical sequences D3ZPW7
10116.ENSRNOP00000013979 NP_001099881.1.100692 NP_001099881.1.4139 ENSRNOP00000013979 ENSRNOP00000013979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]