SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014128 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014128
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.19e-76
Family Phosphate binding protein-like 0.00000421
Further Details:      
 
Domain Number 2 Region: 239-301,331-352
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.96e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014128   Gene: ENSRNOG00000010390   Transcript: ENSRNOT00000014127
Sequence length 361
Comment pep:known chromosome:Rnor_5.0:8:47286249:47293618:-1 gene:ENSRNOG00000010390 transcript:ENSRNOT00000014127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGGAATTAEENGSMMRVIRVGTRKSQLARIQTDTVVAMLKTLYPGIQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPC
DAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLDEL
QEFSAIILAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVGVLHD
PETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIQ
VPVQQEDGPEDDPQLVGITARNIPRGAQLAAENLGISLASLLLNKGAKNILDVARQLNDV
R
Download sequence
Identical sequences Q5M893
NP_037300.2.100692 NP_037300.2.4139 ENSRNOP00000014128 10116.ENSRNOP00000014128 ENSRNOP00000060433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]