SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014273 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014273
Domain Number 1 Region: 168-425
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-77
Family Eukaryotic proteases 0.0000000262
Further Details:      
 
Domain Number 2 Region: 49-159
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-33
Family Kringle modules 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014273   Gene: ENSRNOG00000010516   Transcript: ENSRNOT00000014273
Sequence length 432
Comment pep:known chromosome:Rnor_5.0:15:3621553:3627467:-1 gene:ENSRNOG00000010516 transcript:ENSRNOT00000014273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVWLASLFLCALVAHSEGGSELGASDESNCGCQNGGVCVSYKYFSSIRRCSCPKKFKGE
HCEIDTSKTCYHGNGQSYRGKANTDTKGRPCLAWNSPAVLQQTYNAHRSDALSLGLGKHN
YCRNPDNQRRPWCYVQIGLKQFVQECMVQDCSLSKKPSSTVDQQGFQCGQKALRPRFKIV
GGEFTVVENQPWFAAIYLKNKGGSPPSFKCGGSLISPCWVASATHCFVNQPKKEEYVVYL
GQSKRNSYNPGEMKFEVEQLILHEDFSDETLAFHNDIALLKIRTSTGQCAQPSRTIQTIC
LPPRFGDAPFGSDCEITGFGQESATDYFYPKDLKMSVVKIISHEQCKQPHYYGSEINYKM
LCAADPEWKTDSCSGDSGGPLICNIDGRPTLSGIVSWGSGCAEKNKPGVYTRVSYFLNWI
QSHIGEENGLAF
Download sequence
Identical sequences Q3KR76
ENSRNOP00000014273 ENSRNOP00000014273 NP_037217.3.100692 NP_037217.3.4139 10116.ENSRNOP00000014273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]