SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014478 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014478
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 1.12e-40
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.31e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 6-82
Classification Level Classification E-value
Superfamily F-box domain 2.75e-17
Family F-box domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000014478
Domain Number - Region: 418-456
Classification Level Classification E-value
Superfamily ARM repeat 0.00978
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014478   Gene: ENSRNOG00000009549   Transcript: ENSRNOT00000014478
Sequence length 480
Comment pep:known chromosome:Rnor_5.0:3:100608785:100640793:1 gene:ENSRNOG00000009549 transcript:ENSRNOT00000014478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVEAETGLLTLESLPTDPLLLILSFVDYRDLINCCYVSRRLSQLSTHDPLWRRHCKKY
WLITEEEKARKNQCWKSLFIATYSDVGRYINHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVNNVVSGGFPIIRDQIFRYIHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSRDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRI
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKVFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEAEEEEEEENDDSADMDESDESDEDENESDEGEGEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences D4ABP9
NP_001103076.1.100692 NP_001103076.1.4139 ENSRNOP00000014478 ENSRNOP00000014478 10116.ENSRNOP00000014478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]