SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Rattus norvegicus 76_5.0 > ENSRNOP00000014568

Domain assignment for ENSRNOP00000014568 from Rattus norvegicus 76_5.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSRNOP00000014568
Domain Number 1	Region: 16-96
Classification Level	Classification	E-value
Superfamily	CAD & PB1 domains	7.52e-38
Family	PB1 domain	0.0000883
Further Details:

Domain Number 2	Region: 133-251
Classification Level	Classification	E-value
Superfamily	PDZ domain-like	6.84e-23
Family	PDZ domain	0.00000144
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSRNOP00000014568 Gene: ENSRNOG00000010883 Transcript: ENSRNOT00000014568
Sequence length	372
Comment	pep:known chromosome:Rnor_5.0:3:170968975:170990259:1 gene:ENSRNOG00000010883 transcript:ENSRNOT00000014568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MNRGHRHGVSSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV GYADIHGDLLPINNDDNYHKAVSTANPLLRVFIQKKEEADYSAFGTDTLIRKKNVLSNVL RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQAGASLEPEDQDSDEDDIIIEG SGEPQQIPKATPEALSLESLTQIELSFESGQNGFSPLQDTSLVAVPSSLDTESESRAPDQ KLLEEDGTIITL
Download sequence
Identical sequences	D4A2F2 ENSRNOP00000014568 10116.ENSRNOP00000014568 ENSRNOP00000014568 NP_001102079.1.100692 NP_001102079.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]