SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015504 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015504
Domain Number 1 Region: 443-744
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-70
Family Protein kinases, catalytic subunit 0.000000403
Further Details:      
 
Domain Number 2 Region: 280-398
Classification Level Classification E-value
Superfamily Kringle-like 2.13e-34
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 68-156
Classification Level Classification E-value
Superfamily Immunoglobulin 9.23e-22
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015504
Domain Number - Region: 174-261
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0445
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015504   Gene: ENSRNOG00000010974   Transcript: ENSRNOT00000015504
Sequence length 943
Comment pep:known chromosome:Rnor_5.0:17:14050995:14228982:1 gene:ENSRNOG00000010974 transcript:ENSRNOT00000015504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGWVRPSRVPLCVRAVWTAAALLLWTPWTAGEVEDSEAIDTLGQLDGPDSPLPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRVIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGLKTITATGVLYVRLGPTHSPNHNFQDDDQEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRAPKPRELCRDECEVLENDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGTDYRGMASTTKSGHQCQPWALQHPHSHRLSSTEFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRVELCDVPPCSPRDGSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLISQHKQAKLKEISLSTVRFMEELG
EDRFGKVYKGHLFGPAPGEPTQVVAIKTLKDKAEGPLREEFRQEAMLRARLQHPNIVCLL
GVVTKDQPLSMVFSYCCHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHVVAQIA
AGMEFLSSHHVVHKDLATRNVLVYDKLNVRISDLGLFREVYSADYYKLMGNSLLPIRWMS
PEAVMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRSRQVLPCPDDCPAW
VYALMIECWNEFPSGRPRFKDIHGRLRSWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYMAPKQKAQPFPQPQFIPMKGQIRPLVPPAQLYIPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTEDVQNM
PEDVAQSPVQEAEEEEEGSVPETELLGDSDTLQVNEAHVHLEA
Download sequence
Identical sequences D3ZNY8
NP_001100809.1.100692 NP_001100809.1.4139 ENSRNOP00000015504 NYSGRC-IgSF-ENSRNOP00000015504 10116.ENSRNOP00000015504 ENSRNOP00000015504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]