SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015596 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015596
Domain Number 1 Region: 68-174
Classification Level Classification E-value
Superfamily POZ domain 7.26e-22
Family BTB/POZ domain 0.0028
Further Details:      
 
Domain Number 2 Region: 559-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-17
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 666-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000564
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 596-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000861
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 358-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000121
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 516-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000104
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 462-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000233
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 8 Region: 703-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000421
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015596
Domain Number - Region: 419-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00598
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 207-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0833
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015596   Gene: ENSRNOG00000011137   Transcript: ENSRNOT00000015596
Sequence length 908
Comment pep:known chromosome:Rnor_5.0:13:61532188:61554983:1 gene:ENSRNOG00000011137 transcript:ENSRNOT00000015596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRRKVTSDLDEKIHLGYHKDSSEENAAVECGQVTYTQSTERPTPEALQCCQELPTSPD
QRKLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSK
NPSTDVVTLDHVTHSVFQHLLEFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENV
ATFQAELTDKSSPEETLNELTGRLSNNHQCKFCSRHFCYKKSLENHLAKTHRSLLLGKKH
GLKMLERSFSTRRSKRNRKCPVKFDDTSDDEQESGDGSDNLNQESFDKERSDRNDSEDPG
SDYNVEDEELEEEVSDEESDTEQSDKDNDAEEEPEAADSAGSIHEGLAPVVIQNSNKKIL
QCPKCDKTFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNLTVHRKKHSSEVEFHKKE
HKCPYCNKLHASKKTLAKHVKRFHPENAQEFISIKKTKSESWKCDICKKSFTRRPHLEEH
MILHSQDKPFKCTYCEEHFKSRFARLKHQEKFHLGPFPCDICGRQFNDTGNLKRHIECTH
GGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHDDK
RYECDECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVHYKSVHLGEKVWQ
KYKATFHQCDVCKKIFKGKSSLEMHFRTHSGEKPYKCQICNQSFRIKKTLTKHLVIHSDA
RPFNCQHCNATFKRKDKLKYHIDHVHGIKSPDDSLSTSEEKLMSLPIEYSSDDKIFQAET
KQYLDQPKVYQSEAKTMLQNVSAEVCVPVTLVPVQMPDTSSDLVSHTTTLPTSSHEMLPP
QTQPTDYPRAADLAFLEKYTLTPQPANIVHPVRPEQMLDPREPSYLGTLLGLDSTTAVQN
MSTSEHRS
Download sequence
Identical sequences D3ZMX0
ENSRNOP00000015596 10116.ENSRNOP00000015596 ENSRNOP00000015596 NP_001178599.1.100692 NP_001178599.1.4139 XP_006249999.1.100692 XP_006250000.1.100692 XP_006250001.1.100692 XP_006250002.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]