SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015623 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015623
Domain Number 1 Region: 153-250
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.19e-24
Family Middle domain of MutM-like DNA repair proteins 0.018
Further Details:      
 
Domain Number 2 Region: 65-127
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000249
Family N-terminal domain of MutM-like DNA repair proteins 0.012
Further Details:      
 
Domain Number 3 Region: 318-345
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000922
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015623
Domain Number - Region: 244-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0108
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015623   Gene: ENSRNOG00000011688   Transcript: ENSRNOT00000015623
Sequence length 606
Comment pep:known chromosome:Rnor_5.0:16:40849291:40908352:1 gene:ENSRNOG00000011688 transcript:ENSRNOT00000015623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTLNGEKIRARVLPGQAMTGVRGTALQGLLGSALSPAASLAEVTSSAAPMNAKD
SGWKVLRLFNGCVYSGVETLGKELFMYFGPRALRIHFGMKGSILINPPKCENRGGVSPAF
EVQLTNDLICFFDSSVKLRNSVESQQRVRMMEGLDVCSPKFSLSRAESEVKKQRDRMLCD
VLLDQRVLPGVGNIIKNEALFDSGLHPTVKVCQLSDKQAHHLVKMTRDFSILFYRCRKAG
SAISKHYKVYKRPNCAQCHCKIRVCRLGENSRMTYFCPHCQKENPQHVQICSLPFRNAEI
SWTPKGQDCFTDSVARKSEEQWSCMVCTLINKPSATACDACLTTRPVDSVLKNEENSIAF
SNLVKYPFNNFENTHTEIKINRKTVFGNTTLVLTDLSNKSSALARKSSPSQTIDGESQIF
LPTDICFSDPQHISKEGVNYITQPSNKVNMSSTVGAQSKLFTSAHKKLKTAHSLATELKS
YNSGLSNSELQTNIRSDPCSLHASRPQCKTHSRPCVLRVVRKDGENKGRQFYACSLPRGA
QCGFFEWADLSFPFCGHGKRSIMKTVLKIGPNNGKNFFVCPLEKEKQCNFFQWAESGPEM
EIIPGC
Download sequence
Identical sequences D3ZKJ8
ENSRNOP00000015623 NP_001163817.1.100692 NP_001163817.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]