SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015722 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015722
Domain Number 1 Region: 28-144
Classification Level Classification E-value
Superfamily FKBP-like 6.29e-33
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 
Domain Number 2 Region: 147-211
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000802
Family Calbindin D9K 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015722   Gene: ENSRNOG00000011758   Transcript: ENSRNOT00000015722
Sequence length 218
Comment pep:known chromosome:Rnor_5.0:3:70095653:70107822:-1 gene:ENSRNOG00000011758 transcript:ENSRNOT00000015722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLLFRLSVFLGLWVCSGAQGQTKEESTEEVKIEVLHRPENCSKTSRKGDLLNAHYDGYL
AKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIPPSLAYGKEGY
AEGKIPPNATLMFEIELYAVTKGPRSIETFKQIDTDNDRQLSKAEIELYLQKDFEKDAKP
RDKSYQKAVLEDIFKKNDHDGDGFISPKEYNVHQHDEL
Download sequence
Identical sequences D3Z9M5
ENSRNOP00000015722 10116.ENSRNOP00000015722 NP_001099955.2.100692 NP_001099955.2.4139 XP_017447036.1.100692 ENSRNOP00000015722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]