SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015781 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015781
Domain Number 1 Region: 57-197
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.96e-45
Family Molybdopterin synthase subunit MoaE 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015781   Gene: ENSRNOG00000011797   Transcript: ENSRNOT00000015781
Sequence length 200
Comment pep:known chromosome:Rnor_5.0:2:71520174:71532081:1 gene:ENSRNOG00000011797 transcript:ENSRNOT00000015781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEINNSCFSLETKLPSSHQSVEDSASEPSGYEAKDPPQDTLKDVDDVLEKPKDIIQF
TAKKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAENEIRKICND
IRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEI
YEESTSSWKRNKECFWAADD
Download sequence
Identical sequences Q6AY59
NP_001007634.1.100692 NP_001007634.1.4139 XP_017446205.1.100692 ENSRNOP00000015781 10116.ENSRNOP00000015781 ENSRNOP00000015781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]