SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015851 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015851
Domain Number 1 Region: 243-661
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.38e-94
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00051
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.93e-37
Family Ferredoxin domains from multidomain proteins 0.00023
Further Details:      
 
Domain Number 3 Region: 32-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015851   Gene: ENSRNOG00000011849   Transcript: ENSRNOT00000015852
Sequence length 727
Comment pep:known chromosome:Rnor_5.0:9:69728736:69762079:-1 gene:ENSRNOG00000011849 transcript:ENSRNOT00000015852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVKRALIGLSKSPKGYVRSTGTAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFEGKAVAAIAGGLVDAEALVALKDLLNK
VDSDTLCTEEIFPNEGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGNHEFSKVLNAAKKPMVVLGSSA
LQRDDGAAILAAVSSIAQKIRVASGAAAEWKVMNILHRIASQVAALDLGYKPGVEAIRKN
PPKLLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLGEVSPNLVRYDDVE
EANYFQQASELAKLVDQEFLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
Download sequence
Identical sequences Q66HF1
NP_001005550.1.100692 NP_001005550.1.4139 10116.ENSRNOP00000015851 ENSRNOP00000015851 ENSRNOP00000015851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]