SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016195 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016195
Domain Number 1 Region: 30-327
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.22e-107
Family Inorganic pyrophosphatase 0.0000000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016195   Gene: ENSRNOG00000012091   Transcript: ENSRNOT00000016195
Sequence length 330
Comment pep:known chromosome:Rnor_5.0:2:257065673:257142749:1 gene:ENSRNOG00000012091 transcript:ENSRNOT00000016195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLPLLSVGRGWRVGAAALPPRRVMSLYRTEELGHPRSKDYRLFFKHVAGHYISPFHD
IPLKADCEEEHGIPRKKARNDEYKASFNMVVEIPRWTNAKMEIATEEPLNPIKQDTKNGR
LRYTPNIFPHKGYIWNYGALPQTWEDPHLKDKSTNCCGDNDPIDVCEIGSKVLSRGDVVH
VKILGTLALIDQSETDWKIIAINVNDPEAEKFHDIDDVKKFKPGYLEATVNWFRLYKVPD
GKPENKFAFNGEFKNKAFALEVINSAHEHWKEMVMKKCDKGAISCVNVHICDSPFHCTTE
EARSLVESIPTPSMSKESSVEEEVWHFLRN
Download sequence
Identical sequences 10116.ENSRNOP00000016195 NP_001129343.1.100692 NP_001129343.1.4139 ENSRNOP00000016195 ENSRNOP00000016195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]