SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016281 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016281
Domain Number 1 Region: 619-1160
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.33e-148
Family alpha-mannosidase, C-terminal domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 124-496
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.26e-123
Family alpha-mannosidase 0.00000000313
Further Details:      
 
Domain Number 3 Region: 499-613
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 4.25e-29
Family alpha-mannosidase, domain 2 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016281   Gene: ENSRNOG00000012055   Transcript: ENSRNOT00000016281
Sequence length 1161
Comment pep:known chromosome:Rnor_5.0:1:143096200:143115693:-1 gene:ENSRNOG00000012055 transcript:ENSRNOT00000016281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPARHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPALLPYHTANGSWAVLPEPRPSFFSVSPEDCQFAL
GGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWDAEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGSVPRPGPECCWQGAVRYGGGG
GNLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPD
PKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKSRLFRSSVLLVPL
GDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQAQFGTLSEYFDALYKRTGVEPGARP
PGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLETHLRGAEVLYSLALAHARRSG
LTGQYPLSDYAVLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQVIINAA
HYLVLGDKETYSFDPRAPFLQMDDSRVSHDALPERTVIRLDSSPRFVVVFNPLEQERLSV
VSLLVNSPRVRVLSEEGQPLSVQISVQWSSATNMVPDVYQVSVPVRLPALGLGVLQLQPD
LDGPYTLQSSVHVYLNGVKLSVSRQTTFPLRVVDSGTSDFAISNRYMQVWFSGLTGLLKS
VRRVDEEQEQQVDMKLFVYGTRTSKDKSGAYLFLPDNEAKPYVPKKPPVLRVTEGPFFSE
VAAYYEHFHQVIRLYNLPGVEGLSLDVSFQVDIRDYVNKELALRIHTDIDSQGTFFTDLN
GFQVQPRKYLKKLPLQANFYPMPVMAYIQDSQRRLTLHTAQALGVSSLGNGQLEVILDRR
LMQDDNRGLGQGLKDNKITCNHFRLLLERRTLMSPEVQQERSTSYPSLLSHMTSMYLNTP
PLVLPVAKRESTSPTLHSFHPLASPLPCDFHLLNLRMLPAEVSVPVRANPHHQAEDTLPA
ADAALILHRKGFDCGLEAKNLGFNCTTSQGKLALGSLFHGLDVLFLQPTSLTLLYPLASP
SNSTDISLEPMEISTFRLRLG
Download sequence
Identical sequences ENSRNOP00000016281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]