SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016316 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016316
Domain Number 1 Region: 235-550
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 8.44e-63
Family Glutamine synthetase catalytic domain 0.00059
Further Details:      
 
Domain Number 2 Region: 125-231
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 6.28e-20
Family Glutamine synthetase, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016316   Gene: ENSRNOG00000012205   Transcript: ENSRNOT00000016316
Sequence length 561
Comment pep:known chromosome:Rnor_5.0:9:36267205:36294511:1 gene:ENSRNOG00000012205 transcript:ENSRNOT00000016316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDEGDLAQEDTTKDEANSTEGSRVNKLKRTRRKVTKPHLCSADGDEITMANSREMSRNQ
TADLSKPGSAESWSWHNAKDAQDQIPVVKSSLPSAGAPDAEFNPNTDHTRDNAQSLILPQ
LSSRMKHIKQEMAKNHLQFVRFEATDLHGVSRSKSIPAQFFQEKVIHGVFMPRGYLELMP
NPKDNEVNHIRATCFNSDIVLMPELSTFRVLPWAERTARVICDTFTVTGEPLLTSPRYIA
KRQLRQLQDAGFSLLSAFIYDFCIFGVPEVINSKTISFPASTLLSNHDQPFMQELVDGLY
HTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGVQEVARRYNYIASLVIETGF
CNSGILSHSIWDVSGKTNMFYSGSGVERLTLTGKKWLAGLLKHSAALSCLMAPAVNCRKR
YCKDSRDLKDSVPTTWGYNDNSCALNVKCHGEKGTQIENKLGSATANPYLVLAATVAAGL
DGLQSSDGAAAESDESQDLYQPEPSEIPLKMEDALAALEQDECLKQALGETFIRYFVAMK
KYELENEETDAEGNKFLEYFI
Download sequence
Identical sequences Q7TT51
10116.ENSRNOP00000016316 ENSRNOP00000016316 NP_852048.1.100692 NP_852048.1.4139 XP_017451926.1.100692 ENSRNOP00000016316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]