SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016912 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016912
Domain Number 1 Region: 352-527,562-728
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.45e-81
Family YicI catalytic domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 1219-1418,1463-1624
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.38e-78
Family YicI catalytic domain-like 0.00038
Further Details:      
 
Domain Number 3 Region: 108-351
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.73e-48
Family YicI N-terminal domain-like 0.0091
Further Details:      
 
Domain Number 4 Region: 972-1216
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-44
Family YicI N-terminal domain-like 0.0044
Further Details:      
 
Domain Number 5 Region: 1627-1707
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.18e-20
Family Putative glucosidase YicI, domain 3 0.0098
Further Details:      
 
Domain Number 6 Region: 731-811
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.9e-18
Family Putative glucosidase YicI, domain 3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016912   Gene: ENSRNOG00000026177   Transcript: ENSRNOT00000016912
Sequence length 1849
Comment pep:known_by_projection chromosome:Rnor_5.0:4:133643837:133783434:1 gene:ENSRNOG00000026177 transcript:ENSRNOT00000016912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRRFKKFSTLELVLIVLLLILFIVAVVLIVLLANSTEPNEKYTTTWMCSKGTRESPEK
TESVDAETTGTPDTTLTRTTLNFPECPVLSEAERINCIPDQSSNKDTCDQRGCCWDPQGS
ISVPCYFSRNHGYKMESDLANTTAGFTAALKNLASAPVFGNGIENILLTAEYQTSNRFHF
KLTDQTKERYEVPHEHVKPFSGNAASSLNYNVEVFKEPFSIKVTRKSNNRVLFDSSIGPL
LFSDQFLQLSTHLPSANVYGLGEHVHQQYRHDMNWKTWPMFARDTTPNEDGNNLYGVQTF
FLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRITGGILDFYVFLGNTPEQVVQEYLE
LIGRPTLPSYWTLGFQLSRYDYGSLDKMKIVVERNRAAQLPYDVQHADIDYMDQRKDFTY
DPVNFKGFPEFVKELHNNGQKLVIILDPAISNNSLSSNPYGPYDRGSAMKVWVNSSDGNA
LIGKVWPGTTVFPDYTSPNCAVWWKKEIELFHNEVEFDGIWIDMNEVSNFVDGSVSGCSQ
NNLNYPPFTPKVLDGNLFSKTLCMDAVQHWGKQYDVHNLYGYSMAIATEEAVKTVFPDKR
SFILTRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAMNTY
EELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGEDSLLLNSSRHYLNIRYTLLPYLYTL
FYRAHSRGDTVARPLLHEFYEDSNTWDIDRQFLWGPGLLITPVLDQGAEKVKAYVPDATW
YDYETGEQLAWRKQSVEMELPEDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIIALDK
NKEAKGELFWDDGQTKDTVAKNIYLFSEFSVTQNRLDVTISSPNYKDPNNLEFQEIKIFG
TQEIRNVKVKQNGVLLQMSPQVNYNSNLKVATITNIHLVLGEAYTVEWDIYSKDVERIDC
YPDEHGVSEANCTARGCIWEVSNTPGVPHCYFANELYSVSNIQYDSHGATADISLKASPY
SNAFPSTPVNQLQLKVTYHKDQMLQFKIYDPNRSRYEVPVPLNIPSAPSSTPEGRLYDVF
IKENPFGIQIRRNSTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDM
NWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGILLLNSNAMDVTFQPMPALTYR
TTGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDAEIANLYDEM
VAKQIPYDVQYSDIDYMERQLDFKLNPKFSGFPDLINRMKDNGMRVILILDPAISGNETE
PYPAFTRGVENDVFIRYPNNGDIVWGKVWPDYPNIVVNSSLDWDSQVEQYRAYVAFPDFF
RNSTALWWKKEIEELYRNTQEPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNRPPY
MPHLEARDRGLSSKTLCMESEHILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGERGI
VITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYE
MCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKA
HTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARTVAAYFPKARWYDYY
TGVDINARGEWKTLQAPLEYINLHVRGGYILPWQEPAMNTQLSRKKSMGLKAALNDEGLA
EGWLFWDDGKSIRVYGNITNQYYLARFSVSQNTLQTHEMFNNYITGTVPLYLGYIEIWGL
SSPSITSVRISGKNLNEEVLADYNTTTQILRVNVTDKNISLHAFQSLTW
Download sequence
Identical sequences ENSRNOP00000016912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]