SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017005 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017005
Domain Number 1 Region: 290-461
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.15e-58
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000219
Further Details:      
 
Domain Number 2 Region: 460-584
Classification Level Classification E-value
Superfamily E set domains 2.05e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017005   Gene: ENSRNOG00000011879   Transcript: ENSRNOT00000017005
Sequence length 1548
Comment pep:known chromosome:Rnor_5.0:19:49315752:49403632:-1 gene:ENSRNOG00000011879 transcript:ENSRNOT00000017005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDFISLLSADLDLESPKSLYSRDSLKLHPSQNFHRAGLLEESVYDLLPKELQLPPPRE
TSAASMSQTSGGEAGSPPPAVVAADASSAPSSSMGGACSSFTTSSSPTIYSTSVTDSKAM
QVESCSSAVGVSNRGVSEKQLTGNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDEG
CGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMD
IFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLDSQKGTGVKKSPMLCGQYPVKSEGKELK
IVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGF
YQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSSNMTLAVDCVGILKLRNADVEARIGIAG
SKKKSTRARLVFRVNITRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEV
FLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVG
IYVVTNAGRSHDVQPFTYTPDPAAGALSVNVKKEISSPARPCSFEEALKAMKTTGCNVDK
VTILPNALITPLISSSMIKTEDVTPMEVTSEKRSSPIFQTTKTVGSTQQTLETISNIAGN
ASFSSPSSSHLSPENENQQQLQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPSSDAL
LQQAAQFQTRDAQSRDTMQSDSVVNLSQLTEAPQQQQSPLQEQAQIPSNIFPSPNSVSQL
QSTIQQLQAGSFTGSTASGSNGSVDLVQQVLEAQQQLSSVLFSTPDGNENVQEQLNADIF
QVSQIQNSVSPGMFSSTESAVHTRPDNLLPGRADSVHQQTENTLSSQQQQQQQQQQQQQQ
QVIESSAAMVMEMQQSICQAAAQIQSELFPSAASANGSLQQSPVYQQPSHMMSALPTSED
MQMQCELFSSPPAVSGNETSTTTTPQVATPGSTMFQPPNSGDGEETGAQAKQIQSSVFQT
MVQMQHSGDSQPQVNLFSSTKNIMSVQSNGTQQQGNSLFQQGSEMLSLQSGSFLQQSSHS
QAQLFHPQNPIADAQSLSQETQGPMFHSANPIVHSQTSTASSEQLQPSMFHSQSTIAVLQ
GSSVPQDQQSPNIYLSQSSISNLQTNTVAQEEQISFFSAQNSISPLQSTSNTEQQAAFQQ
QPPISHIQTPLLSQEQAQPSQQGLFQPQVALGSLPANPMPQNQQGPIFQTQRPIVGMQSN
SPSQEQQQQQQQQQQQQQQQQQQSILFSNQNAMATMASQKQPPPNMIFSPNQNPMASQEQ
QNQSIFHQQSNMAPMNQEQQPMQFQNQPTVSSLQNPGPTPSESPQTSLFHSSPQIQLVQG
SPSSQEQQVTLFLSPASMSALQTSINQPDMQQSPLYSPQNNIPGIQGSTSSPQPQAALFH
NTTGGTINQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPEQLMAINQPGQPQNEG
QSSVTTLLSQQMPESAPLASSVNNSQNMEKIDLLVSLQSQGNNLTGSF
Download sequence
Identical sequences D3ZGB1
10116.ENSRNOP00000017005 ENSRNOP00000017005 ENSRNOP00000016927 NP_001100895.1.100692 NP_001100895.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]