SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017186 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017186
Domain Number 1 Region: 103-235
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.18e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 24-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.31e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017186   Gene: ENSRNOG00000012801   Transcript: ENSRNOT00000017186
Sequence length 248
Comment pep:known chromosome:Rnor_5.0:1:275050894:275072300:1 gene:ENSRNOG00000012801 transcript:ENSRNOT00000017186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDLTRCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNKP
DWYYTKHPFGQVPVLENSQCQLIYESVIACEYLDDVFPGRKLFPYDPYERARQKMLLELF
CKVPQLSKECLVALRCGRDCTDLKVALRQELCNLEEILEYQNTTFFGGDSISMIDYLVWP
WFERLDVYGLADCVNHTPMLRLWISSMKQDPAVCALHIDKNIFLGFLNLYFQNNPCAFDF
GLCGPIVR
Download sequence
Identical sequences B6DYQ6 Q6AXV9
NP_001012071.1.100692 NP_001012071.1.4139 XP_006231652.1.100692 XP_006231653.1.100692 XP_006231654.1.100692 XP_008758721.1.100692 XP_017444784.1.100692 10116.ENSRNOP00000017186 ENSRNOP00000017186 ENSRNOP00000060669 ENSRNOP00000017186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]