SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017454 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017454
Domain Number 1 Region: 8-365
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 6.41e-99
Family Glutaminase/Asparaginase 0.0000000932
Further Details:      
 
Domain Number 2 Region: 402-557
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-29
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017454   Gene: ENSRNOG00000012843   Transcript: ENSRNOT00000017454
Sequence length 564
Comment pep:known chromosome:Rnor_5.0:6:145692075:145711786:1 gene:ENSRNOG00000012843 transcript:ENSRNOT00000017454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARATGPEQRLLAIYTGGTIGMRSEGGVLVPGRGLAAVLRTLHMLHDEEYARAHSLPEDT
LVLPPASSDQRIIYKVLECQPLFDSSDMTITEWVQIAQTIERHYTQYQGFVVIHGTDTMA
FAASVLSFMLENLQKPVILTGAQVPIHELWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKASWKSHLVVHSNMEPDVGL
LRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGPTKPDLLQELRAAAERGLIIVNCTHCL
QGAVTSDYAPGMAMAGAGIISGFDMTSEAALAKLSYVLGQPGLSLSDRKKLLAKDLRGEM
TLPTTDDLLGDDMLGCRATWLLSMNGSQDADAMKDVLLPGLALAAAHAGDLDTLQAFVEL
GRDLNLKDYSGQTPLHVAARRGHASVVAMLLQKGVDVDACNEDGQSPLLLAVRGRHQSVI
RLLRAAGAHLSPQELEDVGTELCRLASRADSEGLRAWWQAGADLGQPDYDGHCALQVAEA
AGNADVVALLQSLEDRVSAQPQPH
Download sequence
Identical sequences A0A0G2JSM2
ENSRNOP00000017454 10116.ENSRNOP00000017454 ENSRNOP00000017454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]