SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Rattus norvegicus 76_5.0 > ENSRNOP00000017575

Domain assignment for ENSRNOP00000017575 from Rattus norvegicus 76_5.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSRNOP00000017575
Domain Number 1 Region: 460-720
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-54
Family YWTD domain 0.0000000202
Further Details:      
 
Domain Number 2 Region: 202-238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 253-289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 4 Region: 42-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 5 Region: 162-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 81-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 7 Region: 293-329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 376-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 9 Region: 118-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 10 Region: 412-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000692
Family EGF-type module 0.0014
Further Details:      
 
Domain Number 11 Region: 333-371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 12 Region: 731-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017575   Gene: ENSRNOG00000013064   Transcript: ENSRNOT00000017575
Sequence length 999
Comment pep:known chromosome:Rnor_5.0:5:131252608:131320255:1 gene:ENSRNOG00000013064 transcript:ENSRNOT00000017575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGRPERGALRPLALLLLLLLLLLQLQHLSTADPLPGGQGPVKECEEDQFRCRNERCIPSV
WRCDEDNDCSDNSDEDDCPKRTCTDSDFTCDNGHCIPERWKCDGEEECPDGSDESKATCS
SEECPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTLCAPHEFQCSNRSCLASV
FVCDGDDDCGDGSDERGCSDPACPPREFRCGGGGTCIPERWVCDGQFDCEDRSDEAAELC
GRAGQGTTATPAACAPTTQFTCRSGECIHLGWRCDGDRDCKDKSDEADCSPGPCRENDFQ
CGDGTCILAIKRCNQERDCLDGSDEAGCLQESTCEGPRRFQCKSGECVDGGKVCDDQRDC
RDWSDEPQKVCGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECQDPD
ACSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGRSPSLIFTNRHEVRRIDLVKRDYSR
LIPMLKNVVALDVEVDTNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIGEQLHSPEGLAV
DWVHKHIYWTDSGNKTVSVATTDGRRRCTLFNRDLSEPRAIAVDPLRGFMYWSDWGFQAK
IEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFS
TDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQP
KAADACELSAQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPPSTSTT
TLASAMTRTVPATTGAPGTTIHDSTYQNHSTEMPSQTAAVPHSVNIPKAHSTSPSTLSPA
TSNHSQHYGNEGSQMGSTVTAAVIGIIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNP
VYRKTTEEEEEDELHIGRTAQIGHVYPAAISSYDRPLWAEPCLGETRDLEDPAPAHKELF
VLPGEPRSQLHQLPKNPLSELPVVKCKRVALSLEDDGLP
Download sequence
Identical sequences XP_006238633.1.100692 ENSRNOP00000017575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.