SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017712 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017712
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Nudix 3.25e-27
Family MutT-like 0.000000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017712   Gene: ENSRNOG00000013110   Transcript: ENSRNOT00000017712
Sequence length 147
Comment pep:known chromosome:Rnor_5.0:5:62373679:62388693:1 gene:ENSRNOG00000013110 transcript:ENSRNOT00000017712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRACGLIIFRRHLIPKVDNTTIEFLLLQASDGIHHWTPPKGHVDPGENDLETALRETQ
EETGIEASQLIVLEGFRRELNYVARKKPKTVIYWLAEVKDYDVEIRLSQEHQAYRWLGLD
EACQLAQFEEMKATLQEGHQFLCSTPA
Download sequence
Identical sequences Q6PEC0
ENSRNOP00000017712 NP_997479.1.100692 NP_997479.1.4139 ENSRNOP00000017712 10116.ENSRNOP00000017712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]