SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017952 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017952
Domain Number 1 Region: 35-129,158-194
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 3.18e-26
Family 4HBT-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017952   Gene: ENSRNOG00000013437   Transcript: ENSRNOT00000017952
Sequence length 199
Comment pep:known_by_projection chromosome:Rnor_5.0:3:101854193:102019988:1 gene:ENSRNOG00000013437 transcript:ENSRNOT00000017952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPWARRLLPRNAAGSLSTSSASQQAEDHHRQLEAYRYFLPIQTRWQDNDQYGHVNNAVY
YSYFDTIINHYLLRYCGLETSLLISPLVGFMVTNQCKYHTPIGFPQVPLAALAVEKVGRS
SVCYRLALFPPKPTMELPSVNHHDLIDGFFFGHPKLAQFDTLACTTGSSVHVFVNPATSK
PESLPEDFRNSLQKLMSAA
Download sequence
Identical sequences D4AEL0
ENSRNOP00000017952 10116.ENSRNOP00000017952 NP_001138334.1.100692 NP_001138334.1.4139 ENSRNOP00000017952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]