SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018442 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018442
Domain Number 1 Region: 267-573
Classification Level Classification E-value
Superfamily Kelch motif 1.14e-53
Family Kelch motif 0.00023
Further Details:      
 
Domain Number 2 Region: 12-126
Classification Level Classification E-value
Superfamily POZ domain 1.92e-35
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018442   Gene: ENSRNOG00000013809   Transcript: ENSRNOT00000018442
Sequence length 623
Comment pep:known chromosome:Rnor_5.0:4:151741021:151763287:-1 gene:ENSRNOG00000013809 transcript:ENSRNOT00000018442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTQEERQINTEYAVSLLEQLKLFYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMF
MSGLSESKQTHVHLRNVDAAALQMIITYAYTGNLAINDSTVEQLYETACFLQVEDVLQRC
REYLIKKINAENCVRLLSFADLFSCEELKQSAKRMVEHKFTAVYRQEAFMQLSHDLLIDI
LSSDNLNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQRAWFQGLPPN
DKSVVVQGLYKSMPKFFKPRLGMTKEEMMIFIEASSENPCSLYSSVCYSPQAEKVYKLCS
PPADLHKVGTVVTPDNDIYIAGGQVPLKNTKTNHSKTSKLQTAFRTVNCFYWFDAQQNTW
FPKTPMLFVRVKPSLVCCEGYIYAIGGDSVGGELNRRTVERYDTEKDEWTMVSPLPCAWQ
WSAAVVVHDCIYVMTLNLMYCYFPRSDSWVEMAMRQTSRSFASAAAFGDKIFYIGGLHIA
TNSGIRLPSGTVDGSSVTVEIYDVNKNEWKMAANIPAKRYSDPCVRAVVISNSLCVFMRE
THLNERAKYVTYQYDLELDRWSLRQHISERVLWDLGRDFRCTVGKLYPSCLEESPWKPPT
YLFSPDGTEEFELDGEMVALPPV
Download sequence
Identical sequences D3ZVS6
ENSRNOP00000018442 10116.ENSRNOP00000018442 NP_001101331.1.100692 NP_001101331.1.4139 XP_006236610.1.100692 XP_006236611.1.100692 XP_008761114.1.100692 XP_008761115.1.100692 ENSRNOP00000018442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]