SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018849 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018849
Domain Number 1 Region: 97-140
Classification Level Classification E-value
Superfamily LysM domain 0.0000000759
Family LysM domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018849   Gene: ENSRNOG00000014004   Transcript: ENSRNOT00000018849
Sequence length 921
Comment pep:novel chromosome:Rnor_5.0:1:30738090:30826132:1 gene:ENSRNOG00000014004 transcript:ENSRNOT00000018849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLKKKKQAKQNAEIVSAARSHSGKDDSHSVILEQDKSNIAAEGDQSTDEKKKRKNNQLKE
IRRMELKRYYNADDNQSKSHDKKEKKMVVQKPQGTLEYTAGSQDTLNSVALKFNVTPNRL
VELNKLFTHTIVPGQVLFVPDANIPSSTLRLSSSTPGATVSPSSSDAEYDKLPDADLARK
ALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVMIVTPNNIMFDPHKSDPLV
IENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPRDVCPLYRPGEWEDLASEKD
INPFSKFKSINKEKRQQNGERTLALDVKSVGSPEESTERMRTRTEPPDDSESWKLKNLEY
SRGTASEFPSVTQLSVCAALEPTAKENRLLGDEDFVDLEELSSQPGSGMDKGDARKECLP
YDQKKDAPQTIMSAKKGEEQSAPDVTGTESDAELKGALDSETGEKQDEAPEVDKQSGSPE
NWRESTLSIHEDLDKVKLIEFYLNKNKEGSQLSENVLKSELSERKSIEPDGIDITLSSSL
PQAGDSPPESHKEPGTLCVKGGGTPPPKLHPSAEETVTNNKEALDSLESSLDKLCQGAQM
DNRSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFLCIKVGKPMRKSFASHSTTMVQQYG
KRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKEQGFVVVEKEELTMIDNFFSEPT
TKSWEIITVEEAKRRKSTCSYYEEEEEEEEGLPILQSHSALLENMHIEQLARRLPARVQG
YPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDNQIFGAYATHPFRFSDHYYGTG
ETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGGRFGLWLDADLYHGRSNSCSTFN
NDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences ENSRNOP00000018849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]