SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018994 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018994
Domain Number 1 Region: 707-885
Classification Level Classification E-value
Superfamily SPOC domain-like 3.1e-49
Family SPOC domain 0.00031
Further Details:      
 
Domain Number 2 Region: 332-487
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-30
Family Canonical RBD 0.0053
Further Details:      
 
Domain Number 3 Region: 133-233
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000258
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018994   Gene: ENSRNOG00000014161   Transcript: ENSRNOT00000018995
Sequence length 887
Comment pep:novel chromosome:Rnor_5.0:8:114977385:114980224:-1 gene:ENSRNOG00000014161 transcript:ENSRNOT00000018995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGTKHPVPARARDKPRGS
GGGGGHRDGRAAGDANHRASSGRSSGAPGGGGRTGKASGDPGAGGASPRASPLPPPPPPP
GAEPAGPGTTAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPELGRVA
YVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLRGGGSSRRSSSSSAAASTPPPGPP
TPADPLGYLPLHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERAL
DYYGLYDDRGRPYSYQAVCEEDLMPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIE
EVVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGG
LGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRR
LRVDFAKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLRVRDRTPPHLLYSDRDR
TFLEGDWTSLSKSSDRRNSLEGYSRSVRSRSGERWGADGDRSIAKPWEERRKRRSLSSDR
GRTTHSPYEERSRTKGGGQQSERGSDRTPERSRKENHSSEGTKESGSNSLSNSRHSAEER
SHHHHHHEAPDSSHGKKTRESERNHRTTEAEPKTLEEPKHETKKLKTLSEYAQTLQLGWN
GLLVLKNSCFPTSMHILEGDQGVISGLLKDHTSGSKLTQLKIAQRLRLDQPKLDEVTRRI
KQGSPNGYAVLLAIQSTPSGPGAEGMPMVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGG
SKGRDSTGMLYAFPPCDFSQQYLQSALRTLGKLEEEHMVIVIVRDAA
Download sequence
Identical sequences D3ZHD6
XP_017451618.1.100692 XP_236613.6.100692 ENSRNOP00000018994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]