SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019685 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019685
Domain Number 1 Region: 371-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.58e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 305-378
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 9.16e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.013
Further Details:      
 
Domain Number 3 Region: 5-85
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000128
Family Domains B1 and B5 of PheRS-beta, PheT 0.008
Further Details:      
 
Domain Number 4 Region: 219-281
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000314
Family B3/B4 domain of PheRS, PheT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019685   Gene: ENSRNOG00000014119   Transcript: ENSRNOT00000019685
Sequence length 589
Comment pep:known chromosome:Rnor_5.0:9:84083346:84142523:-1 gene:ENSRNOG00000014119 transcript:ENSRNOT00000019685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSVKRDLLFQVLGRTYTDEEFDELCFEFGLELDEITSEKQIISKEQGNVKAQGASDV
VLYKIDVPANRYDLLCLEGLARGLQVFKERIKAPVYKRVMPKGEIQKLIITEETAKVRPF
AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSD
IKFKPLNKTKEYTACELMNIYKTDNHLKHYLHIIESKPLYPVIYDSNGVVLSMPPIINGN
HSKITVNTRNIFIECTGTDLTKAKIVLDIIVTMFSEYCENQFTVEAAEVVSPSGKSSTLP
ELPYRKEMVRADLINKKVGIKETPANLAKLLTRMCLKSEVIGDGNQIEVEIPPTRADVIH
ACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRLDMAAAGFTEALTFALCSQ
EDIADKLGLNISATKAVHIGNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDI
VVQDPSKDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEESGGYVIKASAG
SAFFPGRCAEIFVGGQSIGKLGVLHPDVITKFELTMPCSSLEINIEPFL
Download sequence
Identical sequences Q68FT7
NP_001004252.1.100692 NP_001004252.1.4139 ENSRNOP00000019685 ENSRNOP00000019685 10116.ENSRNOP00000019685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]