SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019806 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019806
Domain Number 1 Region: 117-173
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000367
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 35-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000072
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019806   Gene: ENSRNOG00000014721   Transcript: ENSRNOT00000019806
Sequence length 701
Comment pep:known chromosome:Rnor_5.0:1:33029445:33123739:1 gene:ENSRNOG00000014721 transcript:ENSRNOT00000019806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMIPSGECTYAGRKRRKPIQKRRLTMGTEKSNPSKRHRDRLNTELDHLASLLPFSPDIIS
KLDKLSVLRLSVSYLRVKSFFQALQETCVWSAPALSPEDHSSRGFPVQEGRLLLESLNGF
ALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVF
GQSPHADTDNTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQKKKTPSGTALPPRLSLFCIVAPVLPSVTEMKMKSAFLKAKHRADIVVTMDSRA
KAVTSLCESELHPKLNYLAGRSNGENVISLFRGQTDRSHWTRALARSSCLCLRGGPDLLD
PKGTSGDREEDDQKHILRRSPGARGQREMHKYSYGLETPVHLRHLDWSTEQRSQEGTTKL
TRQPSKSEPSTCLVPHGSCVPYPGSQGMFSASNMASFRESLDHPTGTYCSQMNRPLPDIH
QGQVDPSTCHIPQGSLGSRIPLSGMQCFTARGFSTEDAKLPSLPVNIGTPCNPVLSLEVP
IKMENESGSQDIVEASTTSCVWLGTGDMTRRHLVGFPARMHLKTEPDYRQQVCTPHRGHG
ILGTNPHSRDTVGSCREHAPLYSAHCTCLSPEPPHHLFMCSHSESQHPSLDQDCRAPIVK
REPLDSPSWAAPGHVTVPRMFPKNASITVIPSKGSDGIFLP
Download sequence
Identical sequences Q75NT5
ENSRNOP00000019806 NP_001019456.1.100692 NP_001019456.1.4139 10116.ENSRNOP00000019806 ENSRNOP00000019806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]