SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020325 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020325
Domain Number 1 Region: 52-527
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-134
Family ALDH-like 0.00000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020325   Gene: ENSRNOG00000014645   Transcript: ENSRNOT00000020325
Sequence length 539
Comment pep:known chromosome:Rnor_5.0:18:50814400:50846386:-1 gene:ENSRNOG00000014645 transcript:ENSRNOT00000020325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLARPLCVQTVKASKLSRLWSRPAALMSTLLIHHPQYAWLQDLGLREDNEGVFNGSWG
GRGEVITTYCPANNEPIARVRQASMKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDA
LREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALME
QWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSIAVTKIIAKVLED
NLLPGAICSLTCGGADMGTAMARDERVNLLSFTGSTQVGKQVALMVQERFGKSLLELGGN
NAIIAFEDADLSLVLPSALFAAVGTAGQRCTTVRRLFLHESIHDEVVDRLKNAYSQIRVG
NPWDPNILYGPLHTKQAVSMFVQAVEEAKKEGGTVVYGGKVMDHPGNYVEPTIVTGLVHD
APIVHKETFAPILYVFKFKNEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTALPLAQGIKFQ
Download sequence
Identical sequences Q64057
NP_001258034.1.100692 NP_001258034.1.4139 ENSRNOP00000020325 ENSRNOP00000020325 10116.ENSRNOP00000020325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]