SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020767 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020767
Domain Number 1 Region: 621-1146
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.92e-146
Family alpha-mannosidase, C-terminal domain 0.000000888
Further Details:      
 
Domain Number 2 Region: 121-498
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.26e-140
Family alpha-mannosidase 0.00000000123
Further Details:      
 
Domain Number 3 Region: 501-613
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.11e-30
Family alpha-mannosidase, domain 2 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020767   Gene: ENSRNOG00000015439   Transcript: ENSRNOT00000020767
Sequence length 1148
Comment pep:known chromosome:Rnor_5.0:9:111831033:111987870:1 gene:ENSRNOG00000015439 transcript:ENSRNOT00000020767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRGPRQEGSFPQGQLSILQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGPRGPAGNASQGSAHLHSAQLALQADPKDCLFASQ
SGNQHRDVQMLDVYDLIPFDNPDGGVWKQGFDIKYEADEWDREPLQVFVVPHSHNDPGWL
KTFNDYFRDKTQYIFNNMVLKLKEDSSRKFIWSEISYLAKWWDIIDNPKKEAVKSLLQNG
QLEIVTGGWVMADEATTHYFALIDQLIEGHQWLEKNLGVKPRSGWAIDPFGHSPTMTYLL
KRAGFSHMLIQRVHYSVKKHFSLQKTLEFFWRQNWDLGSTTDILCHMMPFYSYDIPHTCG
PDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYRKKSKLFRTKVLLA
PLGDDFRFSEYTEWDLQYRNYEQLFSYMNSQPHLKVKIQFGTLSDYFDALEKSVAAEKKG
GQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRLRTAEILYHLALKQAQK
YKINKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGD
SAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPKKNIIQLSAQEPRYLVVYNPFEQER
HSVVSVRVNSATVKVLSDLGKAVEVQVSAVWKDMRTTSQAAYEVAFLAHLPPLGLKVYKI
LESQSSSSHLADYFLYNNDGQAESGIFHMKNMVDSGDAITIENSFLTLGFDRSGLMEKVR
RKEDNKQQELKVQFLWYGTTNKRDKSGAYLFLPDGQGQPYVSLRTPFVRVTRGRIYSDVT
CFLEHVTHKVRLYHIQGIEGQSMEVSNIVDIRSVHNREIVMRISSKINNQNRYYTDLNGY
QIQPRRTMAKLPLQANVYPMSTMAYIQDAAHRLTLLSAQSLGASSMASGQIEVFMDRRLM
QDDNRGLGQGVHDNKITANLFRILLEKRNGMNMEEDKKSPVSYPSLLSHMTSAFLNHPFL
PMVLSGQLPSPAIELLSEFRLLQSSLPCDIHLVNLRTIQSKVGKGYSDEAALILHRKVFD
CQLSSRAMGLPCSTTQGKMSIPKLFNNFAVESFIPSSLSLMHSPPDAQNTSEVSLSPMEI
STSRIRLR
Download sequence
Identical sequences P28494
10116.ENSRNOP00000020767 NP_037111.2.100692 NP_037111.2.4139 ENSRNOP00000020767 ENSRNOP00000035621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]