SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020855 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020855
Domain Number 1 Region: 307-402
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000117
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00082
Further Details:      
 
Domain Number 2 Region: 146-199
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000615
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000034
Family HLH, helix-loop-helix DNA-binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020855   Gene: ENSRNOG00000015376   Transcript: ENSRNOT00000020855
Sequence length 595
Comment pep:known chromosome:Rnor_5.0:1:79667893:79687979:-1 gene:ENSRNOG00000015376 transcript:ENSRNOT00000020855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPYPRSGGRGEVKCGGGRGAGVPWDFLPGLMVKAPPGPCLQAQRKEKSRNAARWRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAVGPPAGLA
PGRRGAVALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGS
SVFDYIHPGDHSEVLEQLGLRAATTGPPTPPSVSSTSSSSSSSSLVDTPEIEASPTEASP
AFRVQERSFFVRMKSTLTKRGLNVKASGYKVIHVTGRLRARALGLVALGHTLPPAPLAEL
PLHGHMIVFRLSLGLTILACESRVSDHMDMGPSELVGRSCYQFVHGQDVTRIRQSHLDLL
DKGQVVTGYYRWLQRAGGFVWLQSVATVAGNGKSAGEHHVLWVSHVLSHAEGGQTPLDAF
QLPAIVSQEESSSPGPEPTKEEPPVERKQTVPVEQDKDKDPQARGKRIKVEASPKEVRGS
EDSGEEEVSDPPAPPRPEFTSVIRAGALKHDPVLPWGLTTPGDPSPALLHAGFLPPVVRG
LCTPGTIRYGPAELSLMYPHLHRLGPGPSLPEAFYPTLGLPYPGPTGTRVQRKGD
Download sequence
Identical sequences D3ZJ66
10116.ENSRNOP00000020855 ENSRNOP00000020855 ENSRNOP00000020855 NP_001100949.1.100692 NP_001100949.1.4139 XP_006228475.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]