SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020928 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020928
Domain Number 1 Region: 43-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 107-159
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000209
Family Hairy Orange domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020928   Gene: ENSRNOG00000015318   Transcript: ENSRNOT00000020929
Sequence length 326
Comment pep:known chromosome:Rnor_5.0:5:144713817:144730808:1 gene:ENSRNOG00000015318 transcript:ENSRNOT00000020929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPRAPSGSDGESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGAGFFDARALAVDFRSIG
FRECLTEVVRYLGVLEGPSSHADPVRIRLLSHLNSYAAEMEPSPTTTGALAFPVWPWSFL
HSCPGLPSLSSQLAILGRVPGPVLPNVSSPPYPISALRSAPVHRVPGTIPPAQRNLLPSR
GVTSSQRAHPPERPAAPPPTALGVRAARSIVPILPCSSPAAPGAGKSDDSASGSISSPSP
LGPTGRPAGAVFYHSWVSEITEIGAF
Download sequence
Identical sequences D3ZIH3
ENSRNOP00000020928 NP_001101447.1.100692 NP_001101447.1.4139 ENSRNOP00000020928 10116.ENSRNOP00000020928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]