SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021116 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021116
Domain Number 1 Region: 505-759
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-80
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 166-268
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000066
Further Details:      
 
Domain Number 3 Region: 382-485
Classification Level Classification E-value
Superfamily SRCR-like 9.55e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000916
Further Details:      
 
Domain Number 4 Region: 273-373
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 5 Region: 73-167
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-17
Family Kringle modules 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021116   Gene: ENSRNOG00000015353   Transcript: ENSRNOT00000021116
Sequence length 761
Comment pep:known chromosome:Rnor_5.0:2:247015139:247074636:1 gene:ENSRNOG00000015353 transcript:ENSRNOT00000021116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALARCVLAVILGVLSEVARADPVLHSPLHRPHPSPPRSQHAHYLPSSRRPPRTPRFPLP
PRAPAAQRPQLLSTRHTPPTISRRCGAGEPWGNATNLGVPCLHWDEVPPFLERSPPASWA
ELRGQPHNFCRSPGGAGRPWCFYRNAQGKVDWGYCDCGQGPALPVIRLVGGKSGHEGRVE
LYHAGQWGTICDDQWDDADAEVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNEL
SIEQCPKSSWGEHNCGHKEDAGVSCAPLTDGVIRLSGGKSVHEGRLEVYYRGQWGTVCDD
GWTEMNTYVACRLLGFKYGKQSSVNHFEGSSRPIWLDDVSCSGKEASFIQCSRRQWGRHD
CSHREDVGLTCYPDSDGHRLSPGFPIRLMDGENKREGRVEVFVSGQWGTICDDGWTDKHA
AVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSED
AGVICDYYEKKTSGHGNKETLSSGCGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLKSTH
GDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVI
HRNYRPDSSDYDIALVRLQGSGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTG
RAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLCAGNLQEDNRVDSCQGDSGGPLMCEKP
DETWVVYGVTSWGYGCGIKDTPGVYTRVPAFVPWIKSVTSL
Download sequence
Identical sequences G3V801
ENSRNOP00000021116 10116.ENSRNOP00000021116 ENSRNOP00000021116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]