SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021656 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021656
Domain Number 1 Region: 242-542
Classification Level Classification E-value
Superfamily SPOC domain-like 1.04e-93
Family Ku80 subunit middle domain 0.00000000044
Further Details:      
 
Domain Number 2 Region: 6-241
Classification Level Classification E-value
Superfamily vWA-like 3.46e-49
Family Ku80 subunit N-terminal domain 0.000000051
Further Details:      
 
Domain Number 3 Region: 561-710
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 1.96e-46
Family C-terminal domain of Ku80 0.000000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021656   Gene: ENSRNOG00000016105   Transcript: ENSRNOT00000021656
Sequence length 732
Comment pep:known chromosome:Rnor_5.0:9:79432205:79520611:1 gene:ENSRNOG00000016105 transcript:ENSRNOT00000021656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWSGNKAAVVLCMDVGVAMGNSFPGEESPLEQAKKVMTMFVQRQVFSESKDEIALVLYG
TESTDNALAGKDQYQNITVHRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQR
ETIGKKFGKKHIEVFTDLSSPFSQDQLDIIICNLKKSSISLQFFLPFPIDKNGEPGETED
HDSSFDHCAPSFPQKGLTEQQKEGIHMVTRVMLSLEGKDGLDEIYSFSESLQQLCIFKKI
ERRSLPWPCQLTIGPNLSIRIVAYKSIVQEKFKKSWVVVDARTLKKEDIQKETVYCLNDD
DETEVSKEDTIQGFRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHRRFFMGHQ
VLKVFAAKDDEAAAVALSSLVHALDELNMVAIVRYAYDKRANPQVGVAFPFIKDAYECLV
YVQLPFMEDLRQYMFSSLKNNKKCTPTEAQLSAIDDLIDSMSLVKKNEEEDIIEDLFPTS
KIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCEIPLSKVKTLFPLT
EVVKKKDQVTAQDVFQDNIEEGPAAKKYKTEKEEGHISISSLAEGNVTKVGSVNPVENFR
VLVRQKIASFEEASLQLMSHIEQFLDTNETLYFMKSMDCIKALREEAIQFSEEQRFNSFL
EGLREKVEIKQLNHFWEIVVQDGITLITKDESPGSSVTAEEATKFLTPKDKAKEDTTGLE
EGGDVDDLLDMI
Download sequence
Identical sequences G3V817
ENSRNOP00000021656 ENSRNOP00000021656 10116.ENSRNOP00000021656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]