SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021818 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000021818
Domain Number - Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.00034
Family LysM domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021818   Gene: ENSRNOG00000016298   Transcript: ENSRNOT00000021818
Sequence length 300
Comment pep:known chromosome:Rnor_5.0:2:9409771:9412384:1 gene:ENSRNOG00000016298 transcript:ENSRNOT00000021818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRNQNRTASLAGIQASGHVHTFGNCTDNDMLEEDAEVYELRSRGKEKVRRSTSRDRLD
DIVILTKDIQEGDTLNAVALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKRFSSLTET
LHPLKGRQVLHPPPVPYFQEQDTVPANDSPSSSESAGSFLKEVDRDIEQIVKCTDTKKEN
LNEVVSALTAQQVRFEPDNKSVHRKDPYYGADWGMGWWTAVVIMLIVGIITPVFYLLYYE
ILAKVDVSHHSTVDSSHLHPGLTPPSHHREMGNAIGPTKGIPVGQQDDHRLYRQDPQARD
Download sequence
Identical sequences Q5M836
10116.ENSRNOP00000021818 NP_001009698.1.100692 NP_001009698.1.4139 ENSRNOP00000021818 ENSRNOP00000021818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]