SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021840 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021840
Domain Number 1 Region: 163-311
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-42
Family Mannose 6-phosphate receptor domain 0.000000248
Further Details:      
 
Domain Number 2 Region: 315-459
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.4e-41
Family Mannose 6-phosphate receptor domain 0.000000759
Further Details:      
 
Domain Number 3 Region: 619-753
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.92e-39
Family Mannose 6-phosphate receptor domain 0.00052
Further Details:      
 
Domain Number 4 Region: 1360-1498
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-35
Family Mannose 6-phosphate receptor domain 0.00047
Further Details:      
 
Domain Number 5 Region: 1506-1637
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.19e-35
Family Mannose 6-phosphate receptor domain 0.000000282
Further Details:      
 
Domain Number 6 Region: 1214-1353
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-34
Family Mannose 6-phosphate receptor domain 0.00013
Further Details:      
 
Domain Number 7 Region: 463-610
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.19e-33
Family Mannose 6-phosphate receptor domain 0.0008
Further Details:      
 
Domain Number 8 Region: 750-915
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-32
Family Mannose 6-phosphate receptor domain 0.0019
Further Details:      
 
Domain Number 9 Region: 1059-1209
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.19e-31
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 10 Region: 39-159
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-30
Family Mannose 6-phosphate receptor domain 0.00000197
Further Details:      
 
Domain Number 11 Region: 2123-2270
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.14e-29
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 12 Region: 1642-1787
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.19e-29
Family Mannose 6-phosphate receptor domain 0.00095
Further Details:      
 
Domain Number 13 Region: 1978-2116
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.16e-29
Family Mannose 6-phosphate receptor domain 0.0016
Further Details:      
 
Domain Number 14 Region: 1790-1885,1936-1979
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.24e-22
Family Mannose 6-phosphate receptor domain 0.0025
Further Details:      
 
Domain Number 15 Region: 925-1068
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-21
Family Mannose 6-phosphate receptor domain 0.0037
Further Details:      
 
Domain Number 16 Region: 1886-1934
Classification Level Classification E-value
Superfamily Kringle-like 2.54e-16
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021840   Gene: ENSRNOG00000014997   Transcript: ENSRNOT00000021840
Sequence length 2481
Comment pep:known chromosome:Rnor_5.0:1:51488769:51577141:-1 gene:ENSRNOG00000014997 transcript:ENSRNOT00000021840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVLPGPVPSGPRVALLLPLLLLLLVAAAGSAQAQAVDLDALCSYTWEAVDSKNNAVYK
INPCGHVDNPRCGPTSAVCMCDLKSENCRSVGDSLLRSSAKSLLEFNTTTGCQPSEHRIQ
TSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKDIFKADKEVPCYVFDDKLQKHDLN
PLIKLNGGYLVDDSDADASLFINVCRDIDSLRDPSTQLRVCPAGTAACLLKGNQAFDVGR
PKEGLKLLSKDRLVLTYVKEEGEKPDFCNGHSPAVTVTFVCPSERREGTIPKLTAKSNCR
YEVEWITEYACHRDYLESETCSLSSEQHDIAIDLSPLAQHEEGSPYVADGGEYRFFMNVC
GDTKVSLCNKEAAVCQEKKVDSTQVKIAGRHQNQTLRYSDGDLTLIYSGGDECSSGFQRM
SVINFECNKTAGQDGRGEPVFTGEVDCTYFFTWDTKYACVKEKEDLLCGAIDGKKRYDLS
VLARHSESEQNWEAVDGSQAESEKRNFFINVCHRVLQAGKAKNCPEGAAVCAVDKSGSKN
LGKFVSSPTKEKGHIQLSYSDGDDCGNDKKITTNITFVCKPGDLESAPVLRAAGPDGCSY
EFEWHTAAACVLSQTEGENCTVLDAQAGFSFDLSLLTKKNGAYKVETDKYDFYINVCGPV
SVNLCQSNSGACQVAKSGKSWNLGLSNTKLTYYDGMIQLSYRNGTLYNNEKHTPRSTLIT
FLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECMVTDPSMMEQYDLSSLVKFEG
GRGGNWYAMENSREHFTRRKYYLNVCRPLNPVPGCDRYASACQMKYENNEGSLAETVAIS
NLGVAKTGPVVEESGSLLLEYVNGSACTTSDGRLTTYSTRIHLVCGRGTMNSHPIFTFNW
ECVVSFLWNTEAACPIQTITDSDQACSIRDPNSGFVFNLSPLNYSQGHMVLGIGKTFVFN
ICGTMPACGTVAGKPALGCEAETKIKDIKDLKPERPVGMEKSLQLSAEGFLTLTYKGSSP
SDRGTAFIIRFICNGDIYPGTPKFLHQDIDSARGIRNTFFEFETALACIPSVVDCQVTDP
AGNEYDLSALSMVRKPWTAVDTSVHGKKRRFYLSVCTPLPYIPGCDGIAMGSCMVSEDKS
QNLGVVQISPQATGNGSLSILYVNGDRCGNQRYSTRIVFECAQTSGSPMFQLLNNCEYVF
VWRTVEACPVVREEGDNCQVKDPRHGNLYDLKPLALNDTIISAGEYTYYFRVCGKLSLDV
CSAHDGSKAVSSCQEKKGPQGFQKVAGLLNQKLTFENGLLKMNYSGGDTCHKVYQRSTTI
YFYCDRTTQKPVFLKETLDCSYLFEWRTQYACPPFNVTECSIQDEAGNSIDLSSLSRYSD
NWEAVTRTGATEHYLINVCKSLSPQAGTDPCPPEAAVCLLDGSKPVNLGRVRDGPQWTAG
VTVLKYVDGDLCPDKIRKRSTIIRFTCSDSQVNSRPLFISAVQDCEYTFSWPTPAACPVK
SNIHDDCQVTNPSTGHLFDLSSLSGKAGITASYSEKGMVFMSICEENVNCSPGVGACFGQ
TRISVGQASKRLSYKDQVLQLVYENGSPCPSKSGLRYKSVISFVCRPEAGPTNRPMLISL
DKQSCTLFFSWHTPLACEQATECTVRNGSSIIDLSPLIHRTGGYEAYDESEDDTSDTTPD
FYINICQPLNPMHGVPCPAGASVCKVPVDGPPIDIGRVTGPPIFNPVANEVYLNFESSTP
CLADKYMNYTSLIAFHCRRGISMGTPKLIRNNDCDFVFEWETPIVCPDEVKTQGCAVTDE
QLLYSFNLTSLSTSTFKVTRDAHTYSIGVCTTAADLDQEGCKDGGVCLLSGSKGASFGRL
ASMQLDYRHQDEAVILSYVNGDPCPPETEDGEPCVFPFIYKGETYDECVLEGRAKLWCSK
TANYDRDHEWGFCRPSNSHRMSAIIFTCDENEDIGRPEVFSEDRGCEVTFEWKTKVVCPP
KKMECKFVQKHKTYDLRLLSSLTGSWDFVHEGNSYFINLCQRVYKGPLDCSERASICKKS
ATGQVQVLGLVHTQKLEVIDETVLVTYSKGHSCGGNKTASSVIELTCAKTVGRPAFKRFD
IDSCTYYFYWYSRAACAVRPQEVNMVNGTLTNPVTGKSFSLGEIYFKLFSASGDMRSNGD
NYLYEIQLSSISSSSNPACSGANICQVKPNDQHFSRKVGTSDMTKYYVQDGDLDVVFTSS
STCGKDKTKSVSSTIFFHCDPLLKDGVPEFSHETADCQYLFSWYTSAVCPLGVDFDDENA
VPEYKGLSERSQAVGAVLSLLLVALTGCLLALLLHKKERRETVINKLTNCCRRSSGVSYK
YSKVSKEEETDENETEWLMEEIQVPAARLGKDGQENGHITTKTVKAEALTSLHGDDQDSE
DEVLTIPEVKVHTGRGAEVESSQPLRNPQRKVLKEREGERMGLVRGEKARRGKFRPGQRK
PTTPAKLVSFHDDSDEDLLHI
Download sequence
Identical sequences G3V824
NP_036888.2.100692 NP_036888.2.4139 ENSRNOP00000021840 ENSRNOP00000021840 10116.ENSRNOP00000021840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]