SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021850 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021850
Domain Number 1 Region: 361-584
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.88e-51
Family Galactose oxidase, central domain 0.015
Further Details:      
 
Domain Number 2 Region: 14-132
Classification Level Classification E-value
Superfamily POZ domain 7.06e-39
Family BTB/POZ domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021850   Gene: ENSRNOG00000016183   Transcript: ENSRNOT00000021850
Sequence length 584
Comment pep:known chromosome:Rnor_5.0:5:139150941:139184255:1 gene:ENSRNOG00000016183 transcript:ENSRNOT00000021850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKEEYAKAADSSFSSDKHAQLILAQMNKMRTGQHFCDVQLQVGKETFQVHRLVLAASSP
YFAALFTGGMKESSKDVVQILGVEAGIFQLLLDFIYTGLVNIAVSNVQELIVAADMLQLT
EVVNLCCDFLKGQIDPQNCIGLFQFSEQIACHDLLEFTENYIHVHFLEVHSGEEFLALTK
DQLIRILRSEELSIEDEYQVFLAAMQWILKDLGKRRKHVVEVLDPVRFPLLPSQRLLKYI
EGVSDFNLRVALQTLLKEYCEVCKSPKENKFCSFLQTSKARPRKKARKYLYAVGGYTRLQ
GGRWSDSRALSCVERFDTFSQYWTTVSSLHQARCGLGVAVLGGMVYAIGGEKDSMIFDCT
ECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGDTIERFDPDENKWEVV
GNMAVSRYYFGCCEMQGLIYAVGGISNEGLELRSFEVYDPLSKRWSPLPPMGTRRAYLGV
AALNDCIYAIGGWNETQDALHTVEKYSFEEEKWIEVASMKVPRAGMCVVAVNGLLYVSGG
RSSSHDFLAPGTLDSVEVYNPHSDTWTEIGNMITSRCEGGVAVL
Download sequence
Identical sequences D4A1F4
RnR264 NP_001100149.2.100692 NP_001100149.2.4139 XP_006238702.1.100692 XP_006238704.1.100692 XP_008762214.1.100692 XP_017448764.1.100692 ENSRNOP00000021850 10116.ENSRNOP00000021850 ENSRNOP00000060894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]